PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID AT1G46480.1
Common NameF2G19.11, WOX4
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis
Family WOX
Protein Properties Length: 251aa    MW: 28675.3 Da    PI: 9.8331
Description WUSCHEL related homeobox 4
Gene Model
Gene Model ID Type Source Coding Sequence
AT1G46480.1genomeTAIRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox64.71.3e-2089148357
                  --SS--HHHHHHHHHHHHH.SSS--HHHHHHHHHHC....TS-HHHHHHHHHHHHHHHHC CS
     Homeobox   3 kRttftkeqleeLeelFek.nrypsaeereeLAkkl....gLterqVkvWFqNrRakekk 57 
                  +R+++t+eq+ +Le l++   r+p+a+++e+++ +l    +++ ++V++WFqN++a+e++
  AT1G46480.1  89 TRWNPTQEQIGILEMLYKGgMRTPNAQQIEHITLQLgkygKIEGKNVFYWFQNHKARERQ 148
                  7*****************99**************************************97 PP

2Wus_type_Homeobox116.21.6e-3789150465
  Wus_type_Homeobox   4 tRWtPtpeQikiLeelyksGlrtPnkeeiqritaeLeeyGkiedkNVfyWFQNrkaRerqkq 65 
                        tRW+Pt+eQi iLe+lyk G+rtPn+++i++it +L +yGkie+kNVfyWFQN+kaRerqkq
        AT1G46480.1  89 TRWNPTQEQIGILEMLYKGGMRTPNAQQIEHITLQLGKYGKIEGKNVFYWFQNHKARERQKQ 150
                        8***********************************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS500719.76684149IPR001356Homeobox domain
SuperFamilySSF466893.59E-1285153IPR009057Homeodomain-like
SMARTSM003898.1E-786153IPR001356Homeobox domain
CDDcd000866.99E-589150No hitNo description
PfamPF000462.6E-1889148IPR001356Homeobox domain
Gene3DG3DSA:1.10.10.602.3E-790148IPR009057Homeodomain-like
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0001944Biological Processvasculature development
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0007165Biological Processsignal transduction
GO:0010067Biological Processprocambium histogenesis
GO:0051301Biological Processcell division
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
Plant Ontology ? help Back to Top
PO Term PO Category PO Description
PO:0000013anatomycauline leaf
PO:0000014anatomyrosette leaf
PO:0000293anatomyguard cell
PO:0005597anatomycambium
PO:0009005anatomyroot
PO:0009006anatomyshoot system
PO:0009046anatomyflower
PO:0009053anatomypeduncle
PO:0020030anatomycotyledon
PO:0020100anatomyhypocotyl
PO:0025275anatomyprocambium
Sequence ? help Back to Top
Protein Sequence    Length: 251 aa     Download sequence    Send to blast
MKVHEFSNGF SSSWDQHDST SSLSLSCKRL RPLAPKLSGS PPSPPSSSSG VTSATFDLKN  60
FIRPDQTGPT KFEHKRDPPH QLETHPGGTR WNPTQEQIGI LEMLYKGGMR TPNAQQIEHI  120
TLQLGKYGKI EGKNVFYWFQ NHKARERQKQ KRNNLISLSC QSSFTTTGVF NPSVTMKTRT  180
SSSLDIMREP MVEKEELVEE NEYKRTCRSW GFENLEIENR RNKNSSTMAT TFNKIIDNVT  240
LELFPLHPEG R
Expression -- Microarray ? help Back to Top
Source ID E-value
GEO2402542250.0
Expression AtlasAT1G46480-
AtGenExpressAT1G46480-
Functional Description ? help Back to Top
Source Description
TAIREncodes a WUSCHEL-related homeobox gene family member with 65 amino acids in its homeodomain. Proteins in this family contain a sequence of eight residues (TLPLFPMH) downstream of the homeodomain called the WUS box. This protein also contains an acidic domain approximately 10 residues upstream of the WUS box. Part of the TDIF-TDR-WOX4 signaling pathway that plays a crucial role in the maintenance of the vascular meristem organization during secondary growth.
UniProtTranscription factor which may be involved in developmental processes. {ECO:0000250}.
Function -- GeneRIF ? help Back to Top
  1. Arabidopsis plants with down-regulated WOX4 expression exhibit reduced vascular development and overaccumulate undifferentiated ground tissue.
    [PMID: 20044450]
  2. WOX4 is upregulated very rapidly in response to TDIF application in a TDR-dependent manner.
    [PMID: 20729381]
  3. Auxin-dependent stimulation of cambium activity depends on WOX4 and its upstream regulator PXY.
    [PMID: 21926336]
  4. WOX4 acts redundantly with WOX14 in the regulation of vascular cell division, but not in regulating vascular organisation
    [PMID: 23578929]
Cis-element ? help Back to Top
SourceLink
PlantRegMapAT1G46480.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Interaction ? help Back to Top
Source Intact With
IntActSearch Q6X7J9
Phenotype -- Mutation ? help Back to Top
Source ID
T-DNA ExpressAT1G46480
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAY2513960.0AY251396.1 Arabidopsis thaliana WOX4 protein mRNA, complete cds.
GenBankBT0106920.0BT010692.1 Arabidopsis thaliana At1g46480 mRNA, complete cds.
GenBankBT0109740.0BT010974.1 Arabidopsis thaliana At1g46480 mRNA, complete cds.
GenBankFJ4408500.0FJ440850.1 Arabidopsis thaliana WOX4 mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_175145.20.0WUSCHEL related homeobox 4
SwissprotQ6X7J90.0WOX4_ARATH; WUSCHEL-related homeobox 4
TrEMBLA0A384KVK60.0A0A384KVK6_ARATH; WOX4
TrEMBLB7U6X40.0B7U6X4_ARATH; WOX4
STRINGAT1G46480.10.0(Arabidopsis thaliana)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM59802747
Representative plantOGRP71671117
Publications ? help Back to Top
  1. Riechmann JL, et al.
    Arabidopsis transcription factors: genome-wide comparative analysis among eukaryotes.
    Science, 2000. 290(5499): p. 2105-10
    [PMID:11118137]
  2. Haecker A, et al.
    Expression dynamics of WOX genes mark cell fate decisions during early embryonic patterning in Arabidopsis thaliana.
    Development, 2004. 131(3): p. 657-68
    [PMID:14711878]
  3. Wagner R,Pfannschmidt T
    Eukaryotic transcription factors in plastids--Bioinformatic assessment and implications for the evolution of gene expression machineries in plants.
    Gene, 2006. 381: p. 62-70
    [PMID:16934950]
  4. Rehrauer H, et al.
    AGRONOMICS1: a new resource for Arabidopsis transcriptome profiling.
    Plant Physiol., 2010. 152(2): p. 487-99
    [PMID:20032078]
  5. Ji J, et al.
    WOX4 promotes procambial development.
    Plant Physiol., 2010. 152(3): p. 1346-56
    [PMID:20044450]
  6. Ji J,Shimizu R,Sinha N,Scanlon MJ
    Analyses of WOX4 transgenics provide further evidence for the evolution of the WOX gene family during the regulation of diverse stem cell functions.
    Plant Signal Behav, 2010. 5(7): p. 916-20
    [PMID:20495368]
  7. Hirakawa Y,Kondo Y,Fukuda H
    TDIF peptide signaling regulates vascular stem cell proliferation via the WOX4 homeobox gene in Arabidopsis.
    Plant Cell, 2010. 22(8): p. 2618-29
    [PMID:20729381]
  8. Zhang X,Zong J,Liu J,Yin J,Zhang D
    Genome-wide analysis of WOX gene family in rice, sorghum, maize, Arabidopsis and poplar.
    J Integr Plant Biol, 2010. 52(11): p. 1016-26
    [PMID:20977659]
  9. Agusti J,Lichtenberger R,Schwarz M,Nehlin L,Greb T
    Characterization of transcriptome remodeling during cambium formation identifies MOL1 and RUL1 as opposing regulators of secondary growth.
    PLoS Genet., 2011. 7(2): p. e1001312
    [PMID:21379334]
  10. Arabidopsis Interactome Mapping Consortium
    Evidence for network evolution in an Arabidopsis interactome map.
    Science, 2011. 333(6042): p. 601-7
    [PMID:21798944]
  11. Suer S,Agusti J,Sanchez P,Schwarz M,Greb T
    WOX4 imparts auxin responsiveness to cambium cells in Arabidopsis.
    Plant Cell, 2011. 23(9): p. 3247-59
    [PMID:21926336]
  12. Causier B,Ashworth M,Guo W,Davies B
    The TOPLESS interactome: a framework for gene repression in Arabidopsis.
    Plant Physiol., 2012. 158(1): p. 423-38
    [PMID:22065421]
  13. Etchells JP,Provost CM,Turner SR
    Plant vascular cell division is maintained by an interaction between PXY and ethylene signalling.
    PLoS Genet., 2012. 8(11): p. e1002997
    [PMID:23166504]
  14. Ohmori Y,Tanaka W,Kojima M,Sakakibara H,Hirano HY
    WUSCHEL-RELATED HOMEOBOX4 is involved in meristem maintenance and is negatively regulated by the CLE gene FCP1 in rice.
    Plant Cell, 2013. 25(1): p. 229-41
    [PMID:23371950]
  15. Etchells JP,Provost CM,Mishra L,Turner SR
    WOX4 and WOX14 act downstream of the PXY receptor kinase to regulate plant vascular proliferation independently of any role in vascular organisation.
    Development, 2013. 140(10): p. 2224-34
    [PMID:23578929]
  16. Kim DY,Scalf M,Smith LM,Vierstra RD
    Advanced proteomic analyses yield a deep catalog of ubiquitylation targets in Arabidopsis.
    Plant Cell, 2013. 25(5): p. 1523-40
    [PMID:23667124]
  17. Ding Y, et al.
    Four distinct types of dehydration stress memory genes in Arabidopsis thaliana.
    BMC Plant Biol., 2013. 13: p. 229
    [PMID:24377444]
  18. Zhou Y, et al.
    Control of plant stem cell function by conserved interacting transcriptional regulators.
    Nature, 2015. 517(7534): p. 377-80
    [PMID:25363783]
  19. Dolzblasz A, et al.
    Stem Cell Regulation by Arabidopsis WOX Genes.
    Mol Plant, 2016. 9(7): p. 1028-39
    [PMID:27109605]
  20. Guo X, et al.
    Identification of cyst nematode B-type CLE peptides and modulation of the vascular stem cell pathway for feeding cell formation.
    PLoS Pathog., 2017. 13(2): p. e1006142
    [PMID:28158306]
  21. Denis E, et al.
    WOX14 promotes bioactive gibberellin synthesis and vascular cell differentiation in Arabidopsis.
    Plant J., 2017. 90(3): p. 560-572
    [PMID:28218997]
  22. Kucukoglu M,Nilsson J,Zheng B,Chaabouni S,Nilsson O
    WUSCHEL-RELATED HOMEOBOX4 (WOX4)-like genes regulate cambial cell division activity and secondary growth in Populus trees.
    New Phytol., 2017. 215(2): p. 642-657
    [PMID:28609015]
  23. Yamaguchi YL, et al.
    Root-Knot and Cyst Nematodes Activate Procambium-Associated Genes in Arabidopsis Roots.
    Front Plant Sci, 2017. 8: p. 1195
    [PMID:28747918]