PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID AT1G46408.1
Common NameAGL97, F2G19.10
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis
Family M-type_MADS
Protein Properties Length: 266aa    MW: 29852.8 Da    PI: 3.9564
Description AGAMOUS-like 97
Gene Model
Gene Model ID Type Source Coding Sequence
AT1G46408.1genomeTAIRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF45.59.7e-151249239
                 ---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEE CS
       SRF-TF  2 rienksnrqvtfskRrngilKKAeELSvLCdaevavii 39
                 +i+nk  r v+fskRr+g+  KA+EL+ L dae+a+i 
  AT1G46408.1 12 KIQNKNPRAVSFSKRRKGLYSKASELCLLSDAEIAIIA 49
                 79**********************************96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5006616.806348IPR002100Transcription factor, MADS-box
SMARTSM004325.0E-16366IPR002100Transcription factor, MADS-box
SuperFamilySSF554558.76E-18578IPR002100Transcription factor, MADS-box
PRINTSPR004045.5E-8525IPR002100Transcription factor, MADS-box
CDDcd002662.48E-26583No hitNo description
PfamPF003195.3E-141262IPR002100Transcription factor, MADS-box
PRINTSPR004045.5E-82540IPR002100Transcription factor, MADS-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0005515Molecular Functionprotein binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 266 aa     Download sequence    Send to blast
MGGVKRKIAI EKIQNKNPRA VSFSKRRKGL YSKASELCLL SDAEIAIIAT PVSSNSNAAF  60
YSFGHSSVDN VVAAFLANQR PCDERFWWED ESLLKSENLE ELREAMDSMS TMLRDLKELE  120
KQRDHQTQTL IHQPCSARVC IQDYVTVNFD GFNTEEQTLA VSDNSNNNGL LGNLDECNED  180
FDDLDQIFDT VTNSEFLSVN LEMDDVTVNS EGNTEEQTLA VSDNSNNNGL LGNLDECNED  240
FDDLDQIIEY LTSSEALSMN LKMDDV
Expression -- Microarray ? help Back to Top
Source ID E-value
GEO184015800.0
Expression AtlasAT1G46408-
AtGenExpressAT1G46408-
Functional Description ? help Back to Top
Source Description
UniProtPutative transcription factor.
Cis-element ? help Back to Top
SourceLink
PlantRegMapAT1G46408.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Interaction ? help Back to Top
Source Intact With
BioGRIDAT1G65330, AT1G69120, AT1G77080
IntActSearch Q9C633
Phenotype -- Mutation ? help Back to Top
Source ID
T-DNA ExpressAT1G46408
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC0838350.0AC083835.5 Arabidopsis thaliana chromosome 1 BAC F2G19 genomic sequence, complete sequence.
GenBankCP0026840.0CP002684.1 Arabidopsis thaliana chromosome 1 sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_175144.10.0AGAMOUS-like 97
SwissprotQ9C6330.0AGL97_ARATH; Agamous-like MADS-box protein AGL97
TrEMBLA0A178W5090.0A0A178W509_ARATH; AGL97
STRINGAT1G46408.10.0(Arabidopsis thaliana)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM45417145
Representative plantOGRP1084328
Publications ? help Back to Top
  1. Riechmann JL, et al.
    Arabidopsis transcription factors: genome-wide comparative analysis among eukaryotes.
    Science, 2000. 290(5499): p. 2105-10
    [PMID:11118137]
  2. Parenicov√° L, et al.
    Molecular and phylogenetic analyses of the complete MADS-box transcription factor family in Arabidopsis: new openings to the MADS world.
    Plant Cell, 2003. 15(7): p. 1538-51
    [PMID:12837945]
  3. Boisson B,Giglione C,Meinnel T
    Unexpected protein families including cell defense components feature in the N-myristoylome of a higher eukaryote.
    J. Biol. Chem., 2003. 278(44): p. 43418-29
    [PMID:12912986]
  4. Kofuji R, et al.
    Evolution and divergence of the MADS-box gene family based on genome-wide expression analyses.
    Mol. Biol. Evol., 2003. 20(12): p. 1963-77
    [PMID:12949148]
  5. De Bodt S,Raes J,Van de Peer Y,Theissen G
    And then there were many: MADS goes genomic.
    Trends Plant Sci., 2003. 8(10): p. 475-83
    [PMID:14557044]
  6. de Folter S, et al.
    Comprehensive interaction map of the Arabidopsis MADS Box transcription factors.
    Plant Cell, 2005. 17(5): p. 1424-33
    [PMID:15805477]
  7. Zhang S, et al.
    FERTILIZATION-INDEPENDENT SEED-Polycomb Repressive Complex 2 Plays a Dual Role in Regulating Type I MADS-Box Genes in Early Endosperm Development.
    Plant Physiol., 2018. 177(1): p. 285-299
    [PMID:29523711]