PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID AT1G36000.1
Common NameASL33, LBD5, T22A15.8
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis
Family LBD
Protein Properties Length: 122aa    MW: 14258.5 Da    PI: 7.288
Description LOB domain-containing protein 5
Gene Model
Gene Model ID Type Source Coding Sequence
AT1G36000.1genomeTAIRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF260102.15e-3291091101
       DUF260   1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqqleqlkaelallk 98 
                  +C++C +++r+C++ C +a+yfp e +++++ +++lFG+ n++ +++++pee+++++++s+++e++a+++dP++G +g+i+kl ++++ +ka l +l+
  AT1G36000.1   9 PCSVCITKNRNCPRFCEYAEYFPYELQSQYESANELFGTPNIITMMQHAPEEKKQMLATSIIMEGNAWTEDPISGGFGMIQKLMWKIMLHKAYLRELQ 106
                  7*********************************************************************************************9999 PP

       DUF260  99 eel 101
                  e++
  AT1G36000.1 107 EKI 109
                  875 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089122.6498109IPR004883Lateral organ boundaries, LOB
PfamPF031952.7E-259106IPR004883Lateral organ boundaries, LOB
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0008150Biological Processbiological_process
Sequence ? help Back to Top
Protein Sequence    Length: 122 aa     Download sequence    Send to blast
MEPLGNRRPC SVCITKNRNC PRFCEYAEYF PYELQSQYES ANELFGTPNI ITMMQHAPEE  60
KKQMLATSII MEGNAWTEDP ISGGFGMIQK LMWKIMLHKA YLRELQEKIK EEKEKKPASS  120
LY
Expression -- Microarray ? help Back to Top
Source ID E-value
GEO2402542080.0
Genevisible260187_at0.0
Expression AtlasAT1G36000-
AtGenExpressAT1G36000-
ATTED-IIAT1G36000-
Cis-element ? help Back to Top
SourceLink
PlantRegMapAT1G36000.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Phenotype -- Mutation ? help Back to Top
Source ID
T-DNA ExpressAT1G36000
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAB4738660.0AB473866.1 Arabidopsis thaliana ASL33 mRNA for ASYMMETRIC LEAVES2-like 33 protein, complete cds.
GenBankDQ0564800.0DQ056480.1 Arabidopsis thaliana LOB domain family protein (At1g36000) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_174832.11e-87LOB domain-containing protein 5
SwissprotQ9C8V81e-88LBD5_ARATH; LOB domain-containing protein 5
TrEMBLA0A178WK743e-85A0A178WK74_ARATH; LBD5
STRINGAT1G36000.16e-87(Arabidopsis thaliana)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM122821432
Publications ? help Back to Top
  1. Iwakawa H, et al.
    The ASYMMETRIC LEAVES2 gene of Arabidopsis thaliana, required for formation of a symmetric flat leaf lamina, encodes a member of a novel family of proteins characterized by cysteine repeats and a leucine zipper.
    Plant Cell Physiol., 2002. 43(5): p. 467-78
    [PMID:12040093]
  2. Shuai B,Reynaga-Peña CG,Springer PS
    The lateral organ boundaries gene defines a novel, plant-specific gene family.
    Plant Physiol., 2002. 129(2): p. 747-61
    [PMID:12068116]
  3. Matsumura Y,Iwakawa H,Machida Y,Machida C
    Characterization of genes in the ASYMMETRIC LEAVES2/LATERAL ORGAN BOUNDARIES (AS2/LOB) family in Arabidopsis thaliana, and functional and molecular comparisons between AS2 and other family members.
    Plant J., 2009. 58(3): p. 525-37
    [PMID:19154202]