PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID AT1G34190.1
Common Nameanac017, F23M19.13, NAC017, NTL7, RAO2
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis
Family NAC
Protein Properties Length: 557aa    MW: 62586.8 Da    PI: 4.5626
Description NAC domain containing protein 17
Gene Model
Gene Model ID Type Source Coding Sequence
AT1G34190.1genomeTAIRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM158.72.3e-49171432128
          NAM   2 ppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLp.k.kvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdkevlskkg 97 
                  +pGfrFhPtdeelv++yLk+k+ +k+l++ +vi  vd+yk++P++Lp + ++k+++++w++F++r++ky++  r+nr t++gyWkatgkd+ +   ++
  AT1G34190.1  17 APGFRFHPTDEELVMYYLKRKICRKRLRV-NVIGVVDVYKMDPEELPgQsMLKTGDRQWFYFTPRSRKYPNAARSNRGTENGYWKATGKDRVIEY-NS 112
                  69***************************.99**************96347888999************************************99.99 PP

          NAM  98 elvglkktLvfykgrapkgektdWvmheyrl 128
                  + vglkktLvfy+grap+ge+tdWvmhey++
  AT1G34190.1 113 RSVGLKKTLVFYRGRAPSGERTDWVMHEYTM 143
                  9****************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5100552.99516166IPR003441NAC domain
SuperFamilySSF1019411.05E-5517166IPR003441NAC domain
PfamPF023651.5E-2518142IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0007275Biological Processmulticellular organism development
GO:0070301Biological Processcellular response to hydrogen peroxide
GO:0005634Cellular Componentnucleus
GO:0005789Cellular Componentendoplasmic reticulum membrane
GO:0016021Cellular Componentintegral component of membrane
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
Plant Ontology ? help Back to Top
PO Term PO Category PO Description
PO:0000013anatomycauline leaf
PO:0000037anatomyshoot apex
PO:0000230anatomyinflorescence meristem
PO:0000293anatomyguard cell
PO:0008019anatomyleaf lamina base
PO:0009005anatomyroot
PO:0009006anatomyshoot system
PO:0009009anatomyplant embryo
PO:0009010anatomyseed
PO:0009025anatomyvascular leaf
PO:0009029anatomystamen
PO:0009030anatomycarpel
PO:0009031anatomysepal
PO:0009032anatomypetal
PO:0009046anatomyflower
PO:0009047anatomystem
PO:0009052anatomyflower pedicel
PO:0020030anatomycotyledon
PO:0020038anatomypetiole
PO:0020100anatomyhypocotyl
PO:0020137anatomyleaf apex
PO:0025022anatomycollective leaf structure
PO:0025195anatomypollen tube cell
PO:0025281anatomypollen
PO:0001016developmental stageL mature pollen stage
PO:0001017developmental stageM germinated pollen stage
PO:0001054developmental stagevascular leaf senescent stage
PO:0001078developmental stageplant embryo cotyledonary stage
PO:0001081developmental stagemature plant embryo stage
PO:0001185developmental stageplant embryo globular stage
PO:0004507developmental stageplant embryo bilateral stage
PO:0007064developmental stageLP.12 twelve leaves visible stage
PO:0007095developmental stageLP.08 eight leaves visible stage
PO:0007098developmental stageLP.02 two leaves visible stage
PO:0007103developmental stageLP.10 ten leaves visible stage
PO:0007115developmental stageLP.04 four leaves visible stage
PO:0007123developmental stageLP.06 six leaves visible stage
PO:0007611developmental stagepetal differentiation and expansion stage
PO:0007616developmental stageflowering stage
Sequence ? help Back to Top
Protein Sequence    Length: 557 aa     Download sequence    Send to blast
MADSSPDSCF KGGKFSAPGF RFHPTDEELV MYYLKRKICR KRLRVNVIGV VDVYKMDPEE  60
LPGQSMLKTG DRQWFYFTPR SRKYPNAARS NRGTENGYWK ATGKDRVIEY NSRSVGLKKT  120
LVFYRGRAPS GERTDWVMHE YTMDEDELGR CKNPQEYYAL YKLFKKSGAG PKNGEQYGAP  180
FQEEEWVDDD NEDVNAIAVA VPEQPVVRYE DARRVDERRL FNPVILQLED IDELLNGIPN  240
APGVPQRCIP QVNSEEELQS TLVNNSAREF LPNGQQYNRP SSFDSLETAE VTSAPLVFEK  300
EDFIEMDDLL LIPEFGASST EKAAQFSNHG EFDDFNEFDQ LFHDVSMSLD MEPIDQGTSA  360
NLSSLSDSAN YTSDQKQQLL YQQFQDQTPE NQLNNIMDPS TTLNQITSDI WFEDDQAILF  420
DQQQSFSGAF ASPSSGVMPD STNPTMSVNA QGHEIQNGGG TTSQFSSALW ALMDSIPSTP  480
ASACEGPLNR TFVRMSSFSR MRFNGKANGT PVSTTIAKKG IRNRGFLLLS IVGALCAIFW  540
VLVATVRVSG RSLLLKD
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3ulx_A2e-461814317140Stress-induced transcription factor NAC1
Search in ModeBase
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
At.113940.0flower| root| seed| silique
Expression -- Microarray ? help Back to Top
Source ID E-value
GEO1453363910.0
Genevisible262514_at0.0
Expression AtlasAT1G34190-
AtGenExpressAT1G34190-
ATTED-IIAT1G34190-
Expression -- Description ? help Back to Top
Source Description
UniprotTISSUE SPECIFICITY: Expressed in roots, rosette leaves, cauline leaves, shoot apex, stems and flowers. {ECO:0000269|PubMed:17158162}.
Functional Description ? help Back to Top
Source Description
UniProtTranscriptional activator activated by proteolytic cleavage through regulated intramembrane proteolysis (RIP). Transcriptional activator that acts as positive regulator of AOX1A during mitochondrial dysfunction. Binds directly to AOX1A promoter. Mediates mitochondrial retrograde signaling. {ECO:0000269|PubMed:24045017}.
Function -- GeneRIF ? help Back to Top
  1. RAO2/Arabidopsis NAC domain-containing protein17 (ANAC017) as a direct positive regulator of AOX1a. Plants with mutated rao2/anac017 were more stress sensitive.
    [PMID: 24045017]
  2. ANAC017 plays a major role in responses to hydrogen peroxide-mediated oxidative stress.
    [PMID: 24045018]
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00179DAP27203113Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMapAT1G34190.1
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: By cold and drought stresses. {ECO:0000269|PubMed:17158162}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Phenotype -- Mutation ? help Back to Top
Source ID
T-DNA ExpressAT1G34190
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankBT0007300.0BT000730.1 Arabidopsis thaliana clone RAFL09-58-M22 (R18947) putative NAM (no apical meristem) protein (At1g34190) mRNA, complete cds.
GenBankAY1335520.0AY133552.1 Arabidopsis thaliana At1g34190/F23M19.13 mRNA, complete cds.
GenBankAF3618130.0AF361813.1 Arabidopsis thaliana F23M19.13/F23M19.13 mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_564440.10.0NAC domain containing protein 17
SwissprotQ9XIC50.0NAC17_ARATH; NAC domain-containing protein 17
TrEMBLD7KJF50.0D7KJF5_ARALL; ANAC017
STRINGAT1G34190.10.0(Arabidopsis thaliana)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP9932711
MalvidsOGEM28122667
Publications ? help Back to Top
  1. Riechmann JL, et al.
    Arabidopsis transcription factors: genome-wide comparative analysis among eukaryotes.
    Science, 2000. 290(5499): p. 2105-10
    [PMID:11118137]
  2. Yamada K, et al.
    Empirical analysis of transcriptional activity in the Arabidopsis genome.
    Science, 2003. 302(5646): p. 842-6
    [PMID:14593172]
  3. Hu W,Wang Y,Bowers C,Ma H
    Isolation, sequence analysis, and expression studies of florally expressed cDNAs in Arabidopsis.
    Plant Mol. Biol., 2003. 53(4): p. 545-63
    [PMID:15010618]
  4. Ooka H, et al.
    Comprehensive analysis of NAC family genes in Oryza sativa and Arabidopsis thaliana.
    DNA Res., 2003. 10(6): p. 239-47
    [PMID:15029955]
  5. Kim SY, et al.
    Exploring membrane-associated NAC transcription factors in Arabidopsis: implications for membrane biology in genome regulation.
    Nucleic Acids Res., 2007. 35(1): p. 203-13
    [PMID:17158162]
  6. Barakat A,Wall PK,Diloreto S,Depamphilis CW,Carlson JE
    Conservation and divergence of microRNAs in Populus.
    BMC Genomics, 2007. 8: p. 481
    [PMID:18166134]
  7. Huang YC,Chang YL,Hsu JJ,Chuang HW
    Transcriptome analysis of auxin-regulated genes of Arabidopsis thaliana.
    Gene, 2008. 420(2): p. 118-24
    [PMID:18577427]
  8. Ascencio-Ib
    Global analysis of Arabidopsis gene expression uncovers a complex array of changes impacting pathogen response and cell cycle during geminivirus infection.
    Plant Physiol., 2008. 148(1): p. 436-54
    [PMID:18650403]
  9. Wang Y, et al.
    Transcriptome analyses show changes in gene expression to accompany pollen germination and tube growth in Arabidopsis.
    Plant Physiol., 2008. 148(3): p. 1201-11
    [PMID:18775970]
  10. Ng S, et al.
    A membrane-bound NAC transcription factor, ANAC017, mediates mitochondrial retrograde signaling in Arabidopsis.
    Plant Cell, 2013. 25(9): p. 3450-71
    [PMID:24045017]
  11. Hofmann NR
    Endoplasmic reticulum-localized transcription factors and mitochondrial retrograde regulation.
    Plant Cell, 2013. 25(9): p. 3151
    [PMID:24045018]