PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID AT1G34180.2
Common Nameanac016, F23M19.14, NAC016, NTL3
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis
Family NAC
Protein Properties Length: 576aa    MW: 64840.5 Da    PI: 4.9707
Description NAC domain containing protein 16
Gene Model
Gene Model ID Type Source Coding Sequence
AT1G34180.2genomeTAIRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM153.11.2e-47171552128
          NAM   2 ppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLp.k.............kvkaeekewyfFskrdkkyatgkrknratksgyWka 85 
                  +pGfrFhPtdeelvv+yLk+k+  kkl++ ++i  vd+ykv+P++Lp +             ++k+++++w+fF++r++ky++  r++r t++gyWka
  AT1G34180.2  17 APGFRFHPTDEELVVYYLKRKICCKKLRV-NAIGVVDVYKVDPSELPgNfqhllidfdsclsMLKTGDRQWFFFTPRNRKYPNAARSSRGTATGYWKA 113
                  69***************************.89***************54899***9999998788899****************************** PP

          NAM  86 tgkdkevlskkgelvglkktLvfykgrapkgektdWvmheyrl 128
                  tgkd+ +   +++ vglkktLvfy+grap+ge+tdWvmhey++
  AT1G34180.2 114 TGKDRVIEY-NSRSVGLKKTLVFYRGRAPNGERTDWVMHEYTM 155
                  *******99.999****************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5100550.72616178IPR003441NAC domain
SuperFamilySSF1019416.15E-5217178IPR003441NAC domain
PfamPF023651.3E-2518154IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0010200Biological Processresponse to chitin
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:1900057Biological Processpositive regulation of leaf senescence
GO:0005634Cellular Componentnucleus
GO:0016021Cellular Componentintegral component of membrane
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
Plant Ontology ? help Back to Top
PO Term PO Category PO Description
PO:0000293anatomyguard cell
PO:0009005anatomyroot
PO:0009025anatomyvascular leaf
PO:0009029anatomystamen
PO:0009031anatomysepal
PO:0009047anatomystem
PO:0020030anatomycotyledon
PO:0020100anatomyhypocotyl
PO:0007115developmental stageLP.04 four leaves visible stage
PO:0007123developmental stageLP.06 six leaves visible stage
PO:0007616developmental stageflowering stage
Sequence ? help Back to Top
Protein Sequence    Length: 576 aa     Download sequence    Send to blast
MVDSSRDSCF KAGKFSAPGF RFHPTDEELV VYYLKRKICC KKLRVNAIGV VDVYKVDPSE  60
LPGNFQHLLI DFDSCLSMLK TGDRQWFFFT PRNRKYPNAA RSSRGTATGY WKATGKDRVI  120
EYNSRSVGLK KTLVFYRGRA PNGERTDWVM HEYTMDEEEL GRCKNAKEYY ALYKLYKKSG  180
AGPKNGEQYG APFQEEEWVD SDSEDADSVA VPDYPVVRYE NGPCVDDTKF CNPVKLQLED  240
IEKLLNEIPD APGVNQRQFD EFVGVPQGNS AEVIQSTLLN NSSGEYIDPR TNGMFLPNGQ  300
LYNRDSSFQS HLNSFEATSG MAPLLDNEKE EYIEMNDLLI PELGASSTEK STEFLNHGEF  360
GDVNEYDQLF NDISVFQGTS TDLSCLSNFT NNTSGQRQQL LYEQFQYQTP ENQLNNYMHP  420
STTLNQFTDN MWFKDDQAAL YVQPPQSSSG AFTSQSTGVM PESMNPTMSV NPQYKEGQNG  480
GGTRSQFSSA LWELLESIPS TPASACEGPL NQTFVRMSSF SRIRFNGTSV TSRKVTVAKK  540
RISNRGFLLL SIMGALCAIF WVFKATVGVM GRPLLS
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3ulx_A6e-421815517140Stress-induced transcription factor NAC1
Search in ModeBase
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
At.397880.0root
Expression -- Microarray ? help Back to Top
Source ID E-value
GEO1453363900.0
Genevisible262542_at0.0
Expression AtlasAT1G34180-
AtGenExpressAT1G34180-
ATTED-IIAT1G34180-
Expression -- Description ? help Back to Top
Source Description
UniprotDEVELOPMENTAL STAGE: Induced during normal senescence. {ECO:0000269|PubMed:23926065}.
UniprotTISSUE SPECIFICITY: Expressed in roots, rosette leaves, shoot apex, stems and flowers. {ECO:0000269|PubMed:17158162}.
Functional Description ? help Back to Top
Source Description
UniProtTranscriptional activator activated by proteolytic cleavage through regulated intramembrane proteolysis (RIP) (By similarity). Transcriptional activator that promotes leaf senescence by up-regulating senescence-associated genes in response to developmental and stress-induced senescence signals. Functions in salt and oxidative stress-responsive signaling pathways. Binds to the promoter of NAC029/NAP and NAC059/ORS1 genes (PubMed:23926065). {ECO:0000250|UniProtKB:Q949N0, ECO:0000269|PubMed:23926065}.
Function -- GeneRIF ? help Back to Top
  1. Data suggest that NAC016 regulatory mechanisms promoting leaf senescence exhibit cross-talk with the salt and oxidative stress-responsive signaling pathways.
    [PMID: 23926065]
  2. promotes drought stress responses by repressing AREB1 transcription through a trifurcate feed-forward regulatory loop involving NAP
    [PMID: 26059204]
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00178DAP27203113Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMapAT1G34180.2
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: By cold, salt, drought stress and methyl methanesulfonate (MMS) treatment. {ECO:0000269|PubMed:17158162}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Phenotype -- Disruption Phenotype ? help Back to Top
Source Description
UniProtDISRUPTION PHENOTYPE: Stay-green phenotype during senescence, salt stress and oxidative stress. {ECO:0000269|PubMed:23926065}.
Phenotype -- Mutation ? help Back to Top
Source ID
T-DNA ExpressAT1G34180
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankBT0303440.0BT030344.1 Arabidopsis thaliana At1g34180 mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_001077648.10.0NAC domain containing protein 16
SwissprotA4FVP60.0NAC16_ARATH; NAC domain-containing protein 16
TrEMBLD7KJF40.0D7KJF4_ARALL; ANAC016
STRINGAT1G34180.20.0(Arabidopsis thaliana)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM28122667
Representative plantOGRP9932711
Publications ? help Back to Top
  1. Riechmann JL, et al.
    Arabidopsis transcription factors: genome-wide comparative analysis among eukaryotes.
    Science, 2000. 290(5499): p. 2105-10
    [PMID:11118137]
  2. Ooka H, et al.
    Comprehensive analysis of NAC family genes in Oryza sativa and Arabidopsis thaliana.
    DNA Res., 2003. 10(6): p. 239-47
    [PMID:15029955]
  3. Kim SY, et al.
    Exploring membrane-associated NAC transcription factors in Arabidopsis: implications for membrane biology in genome regulation.
    Nucleic Acids Res., 2007. 35(1): p. 203-13
    [PMID:17158162]
  4. Libault M,Wan J,Czechowski T,Udvardi M,Stacey G
    Identification of 118 Arabidopsis transcription factor and 30 ubiquitin-ligase genes responding to chitin, a plant-defense elicitor.
    Mol. Plant Microbe Interact., 2007. 20(8): p. 900-11
    [PMID:17722694]
  5. Ascencio-Ib
    Global analysis of Arabidopsis gene expression uncovers a complex array of changes impacting pathogen response and cell cycle during geminivirus infection.
    Plant Physiol., 2008. 148(1): p. 436-54
    [PMID:18650403]
  6. Yang TJ,Perry PJ,Ciani S,Pandian S,Schmidt W
    Manganese deficiency alters the patterning and development of root hairs in Arabidopsis.
    J. Exp. Bot., 2008. 59(12): p. 3453-64
    [PMID:18772308]
  7. Kim YS,Sakuraba Y,Han SH,Yoo SC,Paek NC
    Mutation of the Arabidopsis NAC016 transcription factor delays leaf senescence.
    Plant Cell Physiol., 2013. 54(10): p. 1660-72
    [PMID:23926065]
  8. Sakuraba Y,Kim YS,Han SH,Lee BD,Paek NC
    The Arabidopsis Transcription Factor NAC016 Promotes Drought Stress Responses by Repressing AREB1 Transcription through a Trifurcate Feed-Forward Regulatory Loop Involving NAP.
    Plant Cell, 2015. 27(6): p. 1771-87
    [PMID:26059204]