PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID AT1G33280.1
Common NameANAC015, BRN1, NAC015, T16O9.16
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis
Family NAC
Protein Properties Length: 305aa    MW: 35252.7 Da    PI: 8.0651
Description NAC domain containing protein 15
Gene Model
Gene Model ID Type Source Coding Sequence
AT1G33280.1genomeTAIRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM173.37.5e-5481361128
          NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpk..kvka.eekewyfFskrdkkyatgkrknratksgyWkatgkdkevlsk 95 
                  +ppGfrFhPtdeel+++yLkkk++ +k+e+ evikevd++k+ePwdL+   k+ +  ++ewyfFs++d+ky+tg+r+nrat+sg+Wkatg+dk + + 
  AT1G33280.1   8 VPPGFRFHPTDEELLHYYLKKKISYEKFEM-EVIKEVDLNKIEPWDLQDrcKIGStPQNEWYFFSHKDRKYPTGSRTNRATHSGFWKATGRDKCIRN- 103
                  69****************************.99**************952333332456*************************************9. PP

          NAM  96 kgelvglkktLvfykgrapkgektdWvmheyrl 128
                  + +++g++ktLvfykgrap+g+ktdW+mheyr+
  AT1G33280.1 104 SYKKIGMRKTLVFYKGRAPHGQKTDWIMHEYRI 136
                  8999***************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019412.75E-597156IPR003441NAC domain
PROSITE profilePS5100557.8028156IPR003441NAC domain
PfamPF023653.1E-289136IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009834Biological Processplant-type secondary cell wall biogenesis
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:0048829Biological Processroot cap development
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
Plant Ontology ? help Back to Top
PO Term PO Category PO Description
PO:0000035anatomycotyledon vascular system
PO:0020131anatomylateral root cap
PO:0020132anatomycolumella root cap cell
Sequence ? help Back to Top
Protein Sequence    Length: 305 aa     Download sequence    Send to blast
MSSSNGGVPP GFRFHPTDEE LLHYYLKKKI SYEKFEMEVI KEVDLNKIEP WDLQDRCKIG  60
STPQNEWYFF SHKDRKYPTG SRTNRATHSG FWKATGRDKC IRNSYKKIGM RKTLVFYKGR  120
APHGQKTDWI MHEYRIEDTE DDPCEDGWVV CRVFKKKNLF KVGNDVGSNI SNNRLEARSF  180
IRRESPYQGI SMFELNKPEE ISVHQYPQPP MFQPHHKPLS IGYDYSLALL PRESEYQQAC  240
QPSGVEVGTC KAVSEWGIVN CNMVSHEDSS RAMRFEDDGN NTSSTVQPPS NLLSLRGENG  300
FLGLF
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3ulx_A1e-50815815170Stress-induced transcription factor NAC1
Search in ModeBase
Expression -- Microarray ? help Back to Top
Source ID E-value
Genevisible256535_at0.0
Expression AtlasAT1G33280-
AtGenExpressAT1G33280-
ATTED-IIAT1G33280-
Expression -- Description ? help Back to Top
Source Description
UniprotDEVELOPMENTAL STAGE: Detectable in lateral root development when they reach 1 mm long. {ECO:0000269|PubMed:20197506}.
UniprotTISSUE SPECIFICITY: Expressed in the root cap, in both columella (COL) and COL-adjoining lateral root cap (LRC) cells. Also present at low levels expression in the tips of cotyledons and the cotyledon vasculature, as weel as in vasculature of the first pair of true leaves and at the hydathodes. {ECO:0000269|PubMed:20197506}.
Functional Description ? help Back to Top
Source Description
TAIRNAC domain protein. SMB, BRN1, and BRN2 act to regulate root cap maturation, in a partially redundant fashion.BRN1 and BRN2, control the cell wall maturation processes that are required to detach root cap layers from the root.
UniProtTranscription activator. Together with SMB and BRN2, regulates cellular maturation of root cap. Promotes the expression of genes involved in secondary cell walls (SCW) biosynthesis. {ECO:0000269|PubMed:20197506}.
Function -- GeneRIF ? help Back to Top
  1. SMB, BRN1, and BRN2, which are members of the Class IIB NAC transcription factor family, act redundantly to drive cellular differentiation and promote maturation of the root cap and the cell wall separations needed to produce a functional root cap.
    [PMID: 20197506]
Cis-element ? help Back to Top
SourceLink
PlantRegMapAT1G33280.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Phenotype -- Mutation ? help Back to Top
Source ID
T-DNA ExpressAT1G33280
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC0270350.0AC027035.5 Arabidopsis thaliana chromosome 1 BAC T16O9 genomic sequence, complete sequence.
GenBankCP0026840.0CP002684.1 Arabidopsis thaliana chromosome 1 sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_174598.10.0protein BEARSKIN1
SwissprotQ9C8780.0BRN1_ARATH; Protein BEARSKIN1
TrEMBLD7KIH40.0D7KIH4_ARALL; ANAC015
STRINGAT1G33280.10.0(Arabidopsis thaliana)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP1715800
MalvidsOGEM52132648
Publications ? help Back to Top
  1. Riechmann JL, et al.
    Arabidopsis transcription factors: genome-wide comparative analysis among eukaryotes.
    Science, 2000. 290(5499): p. 2105-10
    [PMID:11118137]
  2. Ooka H, et al.
    Comprehensive analysis of NAC family genes in Oryza sativa and Arabidopsis thaliana.
    DNA Res., 2003. 10(6): p. 239-47
    [PMID:15029955]
  3. Bennett T, et al.
    SOMBRERO, BEARSKIN1, and BEARSKIN2 regulate root cap maturation in Arabidopsis.
    Plant Cell, 2010. 22(3): p. 640-54
    [PMID:20197506]
  4. Sun SB,Meng LS,Sun XD,Feng ZH
    Using high competent shoot apical meristems of cockscomb as explants for studying function of ASYMMETRIC LEAVES2-LIKE11 (ASL11) gene of Arabidopsis.
    Mol. Biol. Rep., 2010. 37(8): p. 3973-82
    [PMID:20306306]