PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID AT1G33240.1
Common NameATGTL1, AT-GTL1, GTL1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis
Family Trihelix
Protein Properties Length: 669aa    MW: 74212.7 Da    PI: 5.8532
Description GT-2-like 1
Gene Model
Gene Model ID Type Source Coding Sequence
AT1G33240.1genomeTAIRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1trihelix96.42.6e-3062146187
     trihelix   1 rWtkqevlaLiearremeerlrrgklkkplWeevskkmrergferspkqCkekwenlnkrykkikegekkrtsessstcpyfdqlea 87 
                  rW+++e+laL+++r++m++++r++ lk+plWe+vs+k+ e g++rs+k+Ckek+en++k+yk++ke++++r++++   +++f+qlea
  AT1G33240.1  62 RWPREETLALLRIRSDMDSTFRDATLKAPLWEHVSRKLLELGYKRSSKKCKEKFENVQKYYKRTKETRGGRHDGK--AYKFFSQLEA 146
                  8*********************************************************************86555..5******985 PP

2trihelix104.39.1e-33435519186
     trihelix   1 rWtkqevlaLiearremeerlrrgklkkplWeevskkmrergferspkqCkekwenlnkrykkikegekkrtsessstcpyfdqle 86 
                  rW+k e+laLi++r+ me r++++  k+ lWee+s  m++ g++r++k+Ckekwen+nk+ykk+ke++kkr +++ +tcpyf++l+
  AT1G33240.1 435 RWPKAEILALINLRSGMEPRYQDNVPKGLLWEEISTSMKRMGYNRNAKRCKEKWENINKYYKKVKESNKKR-PQDAKTCPYFHRLD 519
                  8*********************************************************************8.99999*******97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS500906.93455119IPR017877Myb-like domain
SMARTSM007170.01559121IPR001005SANT/Myb domain
CDDcd122035.04E-2661126No hitNo description
PfamPF138372.1E-2061147No hitNo description
SMARTSM007170.011432494IPR001005SANT/Myb domain
PROSITE profilePS500906.667434492IPR017877Myb-like domain
PfamPF138375.8E-22434519No hitNo description
CDDcd122032.64E-29435499No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0008361Biological Processregulation of cell size
GO:0010090Biological Processtrichome morphogenesis
GO:0030308Biological Processnegative regulation of cell growth
GO:0032876Biological Processnegative regulation of DNA endoreduplication
GO:0042631Biological Processcellular response to water deprivation
GO:0045892Biological Processnegative regulation of transcription, DNA-templated
GO:2000037Biological Processregulation of stomatal complex patterning
GO:2000038Biological Processregulation of stomatal complex development
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Plant Ontology ? help Back to Top
PO Term PO Category PO Description
PO:0000013anatomycauline leaf
PO:0000014anatomyrosette leaf
PO:0000037anatomyshoot apex
PO:0000230anatomyinflorescence meristem
PO:0000282anatomytrichome
PO:0000293anatomyguard cell
PO:0000351anatomyguard mother cell
PO:0004011anatomyinitial cell
PO:0006019anatomyleaf abaxial epidermis
PO:0008019anatomyleaf lamina base
PO:0009005anatomyroot
PO:0009006anatomyshoot system
PO:0009009anatomyplant embryo
PO:0009010anatomyseed
PO:0009025anatomyvascular leaf
PO:0009029anatomystamen
PO:0009030anatomycarpel
PO:0009031anatomysepal
PO:0009032anatomypetal
PO:0009046anatomyflower
PO:0009047anatomystem
PO:0009052anatomyflower pedicel
PO:0020030anatomycotyledon
PO:0020038anatomypetiole
PO:0020100anatomyhypocotyl
PO:0020137anatomyleaf apex
PO:0025022anatomycollective leaf structure
PO:0025281anatomypollen
PO:0001054developmental stagevascular leaf senescent stage
PO:0001078developmental stageplant embryo cotyledonary stage
PO:0001081developmental stagemature plant embryo stage
PO:0001185developmental stageplant embryo globular stage
PO:0004507developmental stageplant embryo bilateral stage
PO:0007064developmental stageLP.12 twelve leaves visible stage
PO:0007095developmental stageLP.08 eight leaves visible stage
PO:0007098developmental stageLP.02 two leaves visible stage
PO:0007103developmental stageLP.10 ten leaves visible stage
PO:0007115developmental stageLP.04 four leaves visible stage
PO:0007123developmental stageLP.06 six leaves visible stage
PO:0007611developmental stagepetal differentiation and expansion stage
PO:0007616developmental stageflowering stage
Sequence ? help Back to Top
Protein Sequence    Length: 669 aa     Download sequence    Send to blast
MEQGGGGGGN EVVEEASPIS SRPPANNLEE LMRFSAAADD GGLGGGGGGG GGGSASSSSG  60
NRWPREETLA LLRIRSDMDS TFRDATLKAP LWEHVSRKLL ELGYKRSSKK CKEKFENVQK  120
YYKRTKETRG GRHDGKAYKF FSQLEALNTT PPSSSLDVTP LSVANPILMP SSSSSPFPVF  180
SQPQPQTQTQ PPQTHNVSFT PTPPPLPLPS MGPIFTGVTF SSHSSSTASG MGSDDDDDDM  240
DVDQANIAGS SSRKRKRGNR GGGGKMMELF EGLVRQVMQK QAAMQRSFLE ALEKREQERL  300
DREEAWKRQE MARLAREHEV MSQERAASAS RDAAIISLIQ KITGHTIQLP PSLSSQPPPP  360
YQPPPAVTKR VAEPPLSTAQ SQSQQPIMAI PQQQILPPPP PSHPHAHQPE QKQQQQPQQE  420
MVMSSEQSSL PSSSRWPKAE ILALINLRSG MEPRYQDNVP KGLLWEEIST SMKRMGYNRN  480
AKRCKEKWEN INKYYKKVKE SNKKRPQDAK TCPYFHRLDL LYRNKVLGSG GGSSTSGLPQ  540
DQKQSPVTAM KPPQEGLVNV QQTHGSASTE EEEPIEESPQ GTEKPEDLVM RELIQQQQQL  600
QQQESMIGEY EKIEESHNYN NMEEEEDQEM DEEELDEDEK SAAFEIAFQS PANRGGNGHT  660
EPPFLTMVQ
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1104112KRSSKKCKE
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
At.282060.0flower| root| seed| silique
Expression -- Microarray ? help Back to Top
Source ID E-value
GEO425624780.0
Genevisible261594_at0.0
Expression AtlasAT1G33240-
AtGenExpressAT1G33240-
ATTED-IIAT1G33240-
Expression -- Description ? help Back to Top
Source Description
UniprotTISSUE SPECIFICITY: Mostly expressed in siliques, and, to a lower extent, in growing root hairs, leaves, stems, and flowers. Present in abaxial epidermal cells, predominantly in guard cells, pavement cells, and meristemoids. {ECO:0000269|PubMed:21169508, ECO:0000269|PubMed:9501260}.
Functional Description ? help Back to Top
Source Description
TAIREncodes a plant transcriptional activator that contains two separate, but similar, trihelix DNA-binding domains, similar to GT-2. Gene is expressed in all aerial parts of the plant, with higher level of expression in siliques. At-GTL2 was thought to be a duplicated copy of this gene but is likely to be a cloning artefact, the result of a chimeric clone. Regulates ploidy-dependent cell growth in trichome.
UniProtTranscription repressor that binds specific DNA sequence such as GT3 box 5'-GGTAAA-3' in the SDD1 promoter. Negative regulator of water use efficiency (WUE) via the promotion of stomatal density and distribution by the transcription repression of SDD1. Regulates the expression of several cell cycle genes and endoreduplication, especially in trichomes where it prevents ploidy-dependent plant cell growth. {ECO:0000269|PubMed:19717615, ECO:0000269|PubMed:21169508}.
Function -- GeneRIF ? help Back to Top
  1. Study provides the genetic evidence for the requirement of transcriptional regulation in the repression of ploidy-dependent plant cell growth as well as for an involvement of GTL trihelix proteins in this regulation.
    [PMID: 19717615]
  2. Data identified Arabidopsis GT2-LIKE 1 (GTL1) as a transcriptional repressor of STOMATAL DENSITY AND DISTRIBUTION 1 (SDD1), a negative regulator of stomatal density.
    [PMID: 21691149]
  3. GTL1 actively terminates ploidy-dependent cell growth and its developmentally regulated expression is one of the key determinants of cell size in Arabidopsis leaf hair cells (trichomes).
    [PMID: 23143274]
  4. A trihelix transcription factor GT-2-LIKE1 (GTL1) and its homolog DF1 repress root hair growth. Transcriptional data, combined with genome-wide chromatin-binding data, show that GTL1 and DF1 directly bind the RSL4 promoter and regulate its expression to repress root hair growth.
    [PMID: 29439132]
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00177DAP27203113Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMapAT1G33240.1
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: Down-regulated by water stress. {ECO:0000269|PubMed:21169508}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Regulation -- ATRM (Manually Curated Target Genes) ? help Back to Top
Source Target Gene (A: Activate/R: Repress)
ATRM AT1G04110(R)
Phenotype -- Mutation ? help Back to Top
Source ID
T-DNA ExpressAT1G33240
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC0210450.0AC021045.2 Arabidopsis thaliana chromosome I BAC T9L6 genomic sequence, complete sequence.
GenBankAC0270350.0AC027035.5 Arabidopsis thaliana chromosome 1 BAC T16O9 genomic sequence, complete sequence.
GenBankAJ0032150.0AJ003215.1 Arabidopsis thaliana GTL1 gene.
GenBankCP0026840.0CP002684.1 Arabidopsis thaliana chromosome 1 sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_174594.10.0GT-2-like 1
SwissprotQ9C8820.0GTL1_ARATH; Trihelix transcription factor GTL1
TrEMBLA0A1P8ATZ40.0A0A1P8ATZ4_ARATH; GT-2-like 1
STRINGAT1G33240.10.0(Arabidopsis thaliana)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM62262746
Representative plantOGRP6631573
Publications ? help Back to Top
  1. Riechmann JL, et al.
    Arabidopsis transcription factors: genome-wide comparative analysis among eukaryotes.
    Science, 2000. 290(5499): p. 2105-10
    [PMID:11118137]
  2. Thilmony R,Underwood W,He SY
    Genome-wide transcriptional analysis of the Arabidopsis thaliana interaction with the plant pathogen Pseudomonas syringae pv. tomato DC3000 and the human pathogen Escherichia coli O157:H7.
    Plant J., 2006. 46(1): p. 34-53
    [PMID:16553894]
  3. Breuer C, et al.
    The trihelix transcription factor GTL1 regulates ploidy-dependent cell growth in the Arabidopsis trichome.
    Plant Cell, 2009. 21(8): p. 2307-22
    [PMID:19717615]
  4. Yoo CY, et al.
    The Arabidopsis GTL1 transcription factor regulates water use efficiency and drought tolerance by modulating stomatal density via transrepression of SDD1.
    Plant Cell, 2010. 22(12): p. 4128-41
    [PMID:21169508]
  5. Yoo CY,Hasegawa PM,Mickelbart MV
    Regulation of stomatal density by the GTL1 transcription factor for improving water use efficiency.
    Plant Signal Behav, 2011. 6(7): p. 1069-71
    [PMID:21691149]
  6. Weng H,Yoo CY,Gosney MJ,Hasegawa PM,Mickelbart MV
    Poplar GTL1 is a Ca2+/calmodulin-binding transcription factor that functions in plant water use efficiency and drought tolerance.
    PLoS ONE, 2012. 7(3): p. e32925
    [PMID:22396800]
  7. Breuer C, et al.
    Transcriptional repression of the APC/C activator CCS52A1 promotes active termination of cell growth.
    EMBO J., 2012. 31(24): p. 4488-501
    [PMID:23143274]
  8. Caro E,Desvoyes B,Gutierrez C
    GTL1 keeps cell growth and nuclear ploidy under control.
    EMBO J., 2012. 31(24): p. 4483-5
    [PMID:23188085]
  9. Jin J, et al.
    An Arabidopsis Transcriptional Regulatory Map Reveals Distinct Functional and Evolutionary Features of Novel Transcription Factors.
    Mol. Biol. Evol., 2015. 32(7): p. 1767-73
    [PMID:25750178]
  10. Zheng X, et al.
    The Wheat GT Factor TaGT2L1D Negatively Regulates Drought Tolerance and Plant Development.
    Sci Rep, 2016. 6: p. 27042
    [PMID:27245096]
  11. Shibata M, et al.
    GTL1 and DF1 regulate root hair growth through transcriptional repression of ROOT HAIR DEFECTIVE 6-LIKE 4 in Arabidopsis.
    Development, 2018.
    [PMID:29439132]
  12. Smalle J, et al.
    The trihelix DNA-binding motif in higher plants is not restricted to the transcription factors GT-1 and GT-2.
    Proc. Natl. Acad. Sci. U.S.A., 1998. 95(6): p. 3318-22
    [PMID:9501260]