PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID AT1G33060.1
Common NameANAC014, NAC014
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis
Family NAC
Protein Properties Length: 648aa    MW: 73556 Da    PI: 5.8776
Description NAC 014
Gene Model
Gene Model ID Type Source Coding Sequence
AT1G33060.1genomeTAIRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM171.62.5e-53241511128
          NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLp..kkvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdkevlskk 96 
                  lp GfrF+Ptdeel+++yL+ k++g++le+ +vi+e+d++k+ePwdLp  + +k++++ew+fF++rd+ky++g+r+nrat+ gyWkatgkd++++s k
  AT1G33060.1  24 LPLGFRFRPTDEELINHYLRLKINGRDLEV-RVIPEIDVCKWEPWDLPglSVIKTDDQEWFFFCPRDRKYPSGHRSNRATDIGYWKATGKDRTIKS-K 119
                  699***************************.99***************6448899999**************************************.9 PP

          NAM  97 gelvglkktLvfykgrapkgektdWvmheyrl 128
                  +  +g+kktLvfy+grap+ge+t+W+mheyr+
  AT1G33060.1 120 KMIIGMKKTLVFYRGRAPRGERTNWIMHEYRA 151
                  999***************************96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019414.84E-6415174IPR003441NAC domain
PROSITE profilePS5100558.73824174IPR003441NAC domain
PfamPF023652.1E-2725150IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0007275Biological Processmulticellular organism development
GO:0005634Cellular Componentnucleus
GO:0016021Cellular Componentintegral component of membrane
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
Plant Ontology ? help Back to Top
PO Term PO Category PO Description
PO:0000037anatomyshoot apex
PO:0000230anatomyinflorescence meristem
PO:0000293anatomyguard cell
PO:0009005anatomyroot
PO:0009009anatomyplant embryo
PO:0009010anatomyseed
PO:0009025anatomyvascular leaf
PO:0009029anatomystamen
PO:0009030anatomycarpel
PO:0009031anatomysepal
PO:0009046anatomyflower
PO:0009047anatomystem
PO:0009052anatomyflower pedicel
PO:0020100anatomyhypocotyl
PO:0025022anatomycollective leaf structure
PO:0001078developmental stageplant embryo cotyledonary stage
PO:0001081developmental stagemature plant embryo stage
PO:0001185developmental stageplant embryo globular stage
PO:0004507developmental stageplant embryo bilateral stage
PO:0007115developmental stageLP.04 four leaves visible stage
PO:0007123developmental stageLP.06 six leaves visible stage
PO:0007611developmental stagepetal differentiation and expansion stage
PO:0007616developmental stageflowering stage
Sequence ? help Back to Top
Protein Sequence    Length: 648 aa     Download sequence    Send to blast
MNQIKNKTLP EMTTEQALLS MEALPLGFRF RPTDEELINH YLRLKINGRD LEVRVIPEID  60
VCKWEPWDLP GLSVIKTDDQ EWFFFCPRDR KYPSGHRSNR ATDIGYWKAT GKDRTIKSKK  120
MIIGMKKTLV FYRGRAPRGE RTNWIMHEYR ATDKELDGTG PGQNPYVLCR LFHKPSDSCD  180
PAHCEEIEKV NFTPTTTTRC SPDDTSSEMV QETATSGVHA LDRSDDTERC LSDKGNNDVK  240
PDVSVINNTS VNHAETSRAK DRNLGKTLVE ENPLLRDVPT LHGPILSEKS YYPGQSSIGF  300
ATSHMDSMYS SDFGNCDYGL HFQDGASEQD ASLTDVLDEV FHNHNESSND RKDFVLPNMM  360
HWPGNTRLLS TEYPFLKDSV AFVDGSAEVS GSQQFVPDIL ASRWVSEQNV DSKEAVEILS  420
STGSSRTLTP LHNNVFGQYA SSSYAAIDPF NYNVNQPEQS SFEQSHVDRN ISPSNIFEFK  480
ARSRENQRDL DSVVDQGTAP RRIRLQIEQP LTPVTNKKER DADNYEEEDE VQSAMSKVVE  540
EEPANLSAQG TAQRRIRLQT RLRKPLITLN NTKRNSNGRE GEASHRKEKE DISSSSSWQK  600
QKKSLVQFSS VVIIVAVIVV LVEIWKESRD AKCSFLFHQL DSFKGMFT
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ut4_A1e-461917812169NO APICAL MERISTEM PROTEIN
1ut4_B1e-461917812169NO APICAL MERISTEM PROTEIN
1ut7_A1e-461917812169NO APICAL MERISTEM PROTEIN
1ut7_B1e-461917812169NO APICAL MERISTEM PROTEIN
3swm_A1e-461917815172NAC domain-containing protein 19
3swm_B1e-461917815172NAC domain-containing protein 19
3swm_C1e-461917815172NAC domain-containing protein 19
3swm_D1e-461917815172NAC domain-containing protein 19
3swp_A1e-461917815172NAC domain-containing protein 19
3swp_B1e-461917815172NAC domain-containing protein 19
3swp_C1e-461917815172NAC domain-containing protein 19
3swp_D1e-461917815172NAC domain-containing protein 19
4dul_A1e-461917812169NAC domain-containing protein 19
4dul_B1e-461917812169NAC domain-containing protein 19
Search in ModeBase
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
At.400040.0flower| silique| vegetative tissue
Expression -- Microarray ? help Back to Top
Source ID E-value
Genevisible261616_at0.0
Expression AtlasAT1G33060-
AtGenExpressAT1G33060-
ATTED-IIAT1G33060-
Cis-element ? help Back to Top
SourceLink
PlantRegMapAT1G33060.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Phenotype -- Mutation ? help Back to Top
Source ID
T-DNA ExpressAT1G33060
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankBT0461890.0BT046189.1 Arabidopsis thaliana unknown protein (At1g33060) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_174582.30.0protein NAC 014
SwissprotB5X5700.0NAC14_ARATH; NAC domain-containing protein 14
TrEMBLF4HPG60.0F4HPG6_ARATH; Protein NAC 014
STRINGAT1G33060.20.0(Arabidopsis thaliana)
Publications ? help Back to Top
  1. Riechmann JL, et al.
    Arabidopsis transcription factors: genome-wide comparative analysis among eukaryotes.
    Science, 2000. 290(5499): p. 2105-10
    [PMID:11118137]
  2. Ooka H, et al.
    Comprehensive analysis of NAC family genes in Oryza sativa and Arabidopsis thaliana.
    DNA Res., 2003. 10(6): p. 239-47
    [PMID:15029955]
  3. Bezhani S, et al.
    Unique, shared, and redundant roles for the Arabidopsis SWI/SNF chromatin remodeling ATPases BRAHMA and SPLAYED.
    Plant Cell, 2007. 19(2): p. 403-16
    [PMID:17293567]
  4. Barakat A,Wall PK,Diloreto S,Depamphilis CW,Carlson JE
    Conservation and divergence of microRNAs in Populus.
    BMC Genomics, 2007. 8: p. 481
    [PMID:18166134]
  5. Klopffleisch K, et al.
    Arabidopsis G-protein interactome reveals connections to cell wall carbohydrates and morphogenesis.
    Mol. Syst. Biol., 2011. 7: p. 532
    [PMID:21952135]