PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID AT1G32870.1
Common NameANAC013, ANAC13, F9L11.7, NAC13, NTL1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis
Family NAC
Protein Properties Length: 528aa    MW: 59321.6 Da    PI: 4.7662
Description NAC domain protein 13
Gene Model
Gene Model ID Type Source Coding Sequence
AT1G32870.1genomeTAIRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM157.27.1e-49101351128
          NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLp.k.kvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdkevlskk 96 
                  l+pGfrFhPtdeelvv+yLk+k+++kkl++ e+i e+d+yk++P++Lp k  +k+++++w+fFs rd+k+  g+r++rat++gyWkatgkd+ +++ +
  AT1G32870.1  10 LAPGFRFHPTDEELVVYYLKRKIRRKKLRV-EAIGETDVYKFDPEELPeKaLYKTRDRQWFFFSLRDRKH--GSRSSRATERGYWKATGKDRVIHC-D 103
                  579***************************.89**************95345667899**********86..89**********************.9 PP

          NAM  97 gelvglkktLvfykgrapkgektdWvmheyrl 128
                  ++ vg kktLvf++grap+ge+t+Wvmhey+l
  AT1G32870.1 104 SRPVGEKKTLVFHRGRAPNGERTNWVMHEYTL 135
                  99****************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019417.59E-554160IPR003441NAC domain
PROSITE profilePS5100552.88710160IPR003441NAC domain
PfamPF023652.4E-2612135IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0007275Biological Processmulticellular organism development
GO:0010114Biological Processresponse to red light
GO:0010224Biological Processresponse to UV-B
GO:0031930Biological Processmitochondria-nucleus signaling pathway
GO:1900409Biological Processpositive regulation of cellular response to oxidative stress
GO:0005634Cellular Componentnucleus
GO:0005789Cellular Componentendoplasmic reticulum membrane
GO:0016021Cellular Componentintegral component of membrane
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0005515Molecular Functionprotein binding
Plant Ontology ? help Back to Top
PO Term PO Category PO Description
PO:0000013anatomycauline leaf
PO:0000037anatomyshoot apex
PO:0000230anatomyinflorescence meristem
PO:0000263anatomynon-hair root epidermal cell
PO:0000293anatomyguard cell
PO:0008019anatomyleaf lamina base
PO:0009006anatomyshoot system
PO:0009009anatomyplant embryo
PO:0009010anatomyseed
PO:0009025anatomyvascular leaf
PO:0009029anatomystamen
PO:0009030anatomycarpel
PO:0009031anatomysepal
PO:0009032anatomypetal
PO:0009046anatomyflower
PO:0009047anatomystem
PO:0009052anatomyflower pedicel
PO:0020100anatomyhypocotyl
PO:0025022anatomycollective leaf structure
PO:0025195anatomypollen tube cell
PO:0025281anatomypollen
PO:0001054developmental stagevascular leaf senescent stage
PO:0001078developmental stageplant embryo cotyledonary stage
PO:0001081developmental stagemature plant embryo stage
PO:0001185developmental stageplant embryo globular stage
PO:0004507developmental stageplant embryo bilateral stage
PO:0007123developmental stageLP.06 six leaves visible stage
PO:0007611developmental stagepetal differentiation and expansion stage
PO:0007616developmental stageflowering stage
Sequence ? help Back to Top
Protein Sequence    Length: 528 aa     Download sequence    Send to blast
MDLSVENGGL APGFRFHPTD EELVVYYLKR KIRRKKLRVE AIGETDVYKF DPEELPEKAL  60
YKTRDRQWFF FSLRDRKHGS RSSRATERGY WKATGKDRVI HCDSRPVGEK KTLVFHRGRA  120
PNGERTNWVM HEYTLHKEEL KRCGGEDVKD AYVLYKIYKK SGSGPKNGEQ YGAPFIEEEW  180
AEDDDDDVDE PANQLVVSAS VDNSLWGKGL NQSELDDNDI EELMSQVRDQ SGPTLQQNGV  240
SGLNSHVDTY NLENLEEDMY LEINDLMEPE PEPTSVEVME NNWNEDGSGL LNDDDFVGAD  300
SYFLDLGVTN PQLDFVSGDL KNGFAQSLQV NTSLMTYQAN NNQFQQQSGK NQASNWPLRN  360
SYTRQINNGS SWVQELNNDG LTVTRFGEAP GTGDSSEFLN PVPSGISTTN EDDPSKDESS  420
KFASSVWTFL ESIPAKPAYA SENPFVKLNL VRMSTSGGRF RFTSKSTGNN VVVMDSDSAV  480
KRNKSGGNND KKKKKNKGFF CLSIIGALCA LFWVIIGTMG GSGRPLLW
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ut4_A1e-431016617171NO APICAL MERISTEM PROTEIN
1ut4_B1e-431016617171NO APICAL MERISTEM PROTEIN
1ut7_A1e-431016617171NO APICAL MERISTEM PROTEIN
1ut7_B1e-431016617171NO APICAL MERISTEM PROTEIN
3swm_A1e-431016620174NAC domain-containing protein 19
3swm_B1e-431016620174NAC domain-containing protein 19
3swm_C1e-431016620174NAC domain-containing protein 19
3swm_D1e-431016620174NAC domain-containing protein 19
3swp_A1e-431016620174NAC domain-containing protein 19
3swp_B1e-431016620174NAC domain-containing protein 19
3swp_C1e-431016620174NAC domain-containing protein 19
3swp_D1e-431016620174NAC domain-containing protein 19
4dul_A1e-431016617171NAC domain-containing protein 19
4dul_B1e-431016617171NAC domain-containing protein 19
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
13037KIRRKKLR
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
At.119700.0flower
Expression -- Microarray ? help Back to Top
Source ID E-value
GEO143345710.0
Genevisible261192_at0.0
Expression AtlasAT1G32870-
AtGenExpressAT1G32870-
ATTED-IIAT1G32870-
Expression -- Description ? help Back to Top
Source Description
UniprotTISSUE SPECIFICITY: Expressed in roots, rosette leaves, shoot apex, stems and flowers. {ECO:0000269|PubMed:17158162}.
Functional Description ? help Back to Top
Source Description
UniProtTranscriptional activator activated by proteolytic cleavage through regulated intramembrane proteolysis (RIP). Involved in oxidative stress tolerance by mediating regulation of mitochondrial retrograde signaling during mitochondrial dysfunction. Interacts directly with the mitochondrial dysfunction DNA consensus motif 5'-CTTGNNNNNCA[AC]G-3', a cis-regulatory elements of several mitochondrial retrograde regulation-induced genes, and triggers increased oxidative stress tolerance. {ECO:0000269|PubMed:24045019}.
Function -- GeneRIF ? help Back to Top
  1. ANAC013 plays a role in mitochondrial stress responses.
    [PMID: 24045018]
  2. ANAC013 as a regulator of mitochondrial retrograde regulation (MRR) upon stress in Arabidopsis thaliana.
    [PMID: 24045019]
  3. Protein intrinsic disorder in Arabidopsis NAC transcription factors: transcriptional activation by ANAC013 and ANAC046 and their interactions with RCD1.
    [PMID: 25348421]
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00176DAP27203113Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMapAT1G32870.1
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: By heat, salt stress, abscisic acid (ABA) and methyl methanesulfonate (MMS) treatment. {ECO:0000269|PubMed:17158162}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Interaction ? help Back to Top
Source Intact With
IntActSearch F4IED2
Phenotype -- Mutation ? help Back to Top
Source ID
T-DNA ExpressAT1G32870
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAY0349590.0AY034959.1 Arabidopsis thaliana putative NAM protein (At1g32870) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_564410.10.0NAC domain protein 13
SwissprotF4IED20.0NAC13_ARATH; NAC domain-containing protein 13
TrEMBLD7KID50.0D7KID5_ARALL; Putative uncharacterized protein
STRINGAT1G32870.10.0(Arabidopsis thaliana)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP1715800
MalvidsOGEM153171517
Publications ? help Back to Top
  1. Riechmann JL, et al.
    Arabidopsis transcription factors: genome-wide comparative analysis among eukaryotes.
    Science, 2000. 290(5499): p. 2105-10
    [PMID:11118137]
  2. Yamada K, et al.
    Empirical analysis of transcriptional activity in the Arabidopsis genome.
    Science, 2003. 302(5646): p. 842-6
    [PMID:14593172]
  3. Ulm R, et al.
    Genome-wide analysis of gene expression reveals function of the bZIP transcription factor HY5 in the UV-B response of Arabidopsis.
    Proc. Natl. Acad. Sci. U.S.A., 2004. 101(5): p. 1397-402
    [PMID:14739338]
  4. Ooka H, et al.
    Comprehensive analysis of NAC family genes in Oryza sativa and Arabidopsis thaliana.
    DNA Res., 2003. 10(6): p. 239-47
    [PMID:15029955]
  5. Truman W,de Zabala MT,Grant M
    Type III effectors orchestrate a complex interplay between transcriptional networks to modify basal defence responses during pathogenesis and resistance.
    Plant J., 2006. 46(1): p. 14-33
    [PMID:16553893]
  6. Oravecz A, et al.
    CONSTITUTIVELY PHOTOMORPHOGENIC1 is required for the UV-B response in Arabidopsis.
    Plant Cell, 2006. 18(8): p. 1975-90
    [PMID:16829591]
  7. Kim SY, et al.
    Exploring membrane-associated NAC transcription factors in Arabidopsis: implications for membrane biology in genome regulation.
    Nucleic Acids Res., 2007. 35(1): p. 203-13
    [PMID:17158162]
  8. Fleury D, et al.
    The Arabidopsis thaliana homolog of yeast BRE1 has a function in cell cycle regulation during early leaf and root growth.
    Plant Cell, 2007. 19(2): p. 417-32
    [PMID:17329565]
  9. Safrany J, et al.
    Identification of a novel cis-regulatory element for UV-B-induced transcription in Arabidopsis.
    Plant J., 2008. 54(3): p. 402-14
    [PMID:18266923]
  10. Ascencio-Ib
    Global analysis of Arabidopsis gene expression uncovers a complex array of changes impacting pathogen response and cell cycle during geminivirus infection.
    Plant Physiol., 2008. 148(1): p. 436-54
    [PMID:18650403]
  11. Wang Y, et al.
    Transcriptome analyses show changes in gene expression to accompany pollen germination and tube growth in Arabidopsis.
    Plant Physiol., 2008. 148(3): p. 1201-11
    [PMID:18775970]
  12. Jaspers P, et al.
    Unequally redundant RCD1 and SRO1 mediate stress and developmental responses and interact with transcription factors.
    Plant J., 2009. 60(2): p. 268-79
    [PMID:19548978]
  13. Inz
    A subcellular localization compendium of hydrogen peroxide-induced proteins.
    Plant Cell Environ., 2012. 35(2): p. 308-20
    [PMID:21443605]
  14. Bruex A, et al.
    A gene regulatory network for root epidermis cell differentiation in Arabidopsis.
    PLoS Genet., 2012. 8(1): p. e1002446
    [PMID:22253603]
  15. Hofmann NR
    Endoplasmic reticulum-localized transcription factors and mitochondrial retrograde regulation.
    Plant Cell, 2013. 25(9): p. 3151
    [PMID:24045018]
  16. De Clercq I, et al.
    The membrane-bound NAC transcription factor ANAC013 functions in mitochondrial retrograde regulation of the oxidative stress response in Arabidopsis.
    Plant Cell, 2013. 25(9): p. 3472-90
    [PMID:24045019]
  17. O'Shea C, et al.
    Protein intrinsic disorder in Arabidopsis NAC transcription factors: transcriptional activation by ANAC013 and ANAC046 and their interactions with RCD1.
    Biochem. J., 2015. 465(2): p. 281-94
    [PMID:25348421]