PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID AT1G32240.1
Common NameF27G20.7, KAN2
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis
Family G2-like
Protein Properties Length: 388aa    MW: 43840.6 Da    PI: 7.9492
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
AT1G32240.1genomeTAIRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like101.93.9e-32214267255
      G2-like   2 prlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55 
                  pr+rWt++LH+rFv+ave LGG+e+AtPk++lelm+vk+Ltl+hvkSHLQ+YR+
  AT1G32240.1 214 PRMRWTTTLHARFVHAVELLGGHERATPKSVLELMDVKDLTLAHVKSHLQMYRT 267
                  9****************************************************7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466891.97E-15211267IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.602.0E-28212267IPR009057Homeodomain-like
TIGRFAMsTIGR015572.5E-23214267IPR006447Myb domain, plants
PfamPF002492.6E-7215266IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009944Biological Processpolarity specification of adaxial/abaxial axis
GO:0030154Biological Processcell differentiation
GO:0048481Biological Processplant ovule development
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0044212Molecular Functiontranscription regulatory region DNA binding
Plant Ontology ? help Back to Top
PO Term PO Category PO Description
PO:0000013anatomycauline leaf
PO:0000037anatomyshoot apex
PO:0000230anatomyinflorescence meristem
PO:0000293anatomyguard cell
PO:0008019anatomyleaf lamina base
PO:0009005anatomyroot
PO:0009006anatomyshoot system
PO:0009009anatomyplant embryo
PO:0009010anatomyseed
PO:0009025anatomyvascular leaf
PO:0009029anatomystamen
PO:0009030anatomycarpel
PO:0009031anatomysepal
PO:0009032anatomypetal
PO:0009046anatomyflower
PO:0009047anatomystem
PO:0009052anatomyflower pedicel
PO:0020030anatomycotyledon
PO:0020038anatomypetiole
PO:0020100anatomyhypocotyl
PO:0025022anatomycollective leaf structure
PO:0025281anatomypollen
PO:0001054developmental stagevascular leaf senescent stage
PO:0001078developmental stageplant embryo cotyledonary stage
PO:0001081developmental stagemature plant embryo stage
PO:0001185developmental stageplant embryo globular stage
PO:0004507developmental stageplant embryo bilateral stage
PO:0007098developmental stageLP.02 two leaves visible stage
PO:0007115developmental stageLP.04 four leaves visible stage
PO:0007123developmental stageLP.06 six leaves visible stage
PO:0007611developmental stagepetal differentiation and expansion stage
PO:0007616developmental stageflowering stage
Sequence ? help Back to Top
Protein Sequence    Length: 388 aa     Download sequence    Send to blast
MELFPAQPDL SLQISPPNSK PSSTWQRRRS TTDQEDHEEL DLGFWRRALD SRTSSLVSNS  60
TSKTINHPFQ DLSLSNISHH QQQQQHHHPQ LLPNCNSSNI LTSFQFPTQQ QQQHLQGFLA  120
HDLNTHLRPI RGIPLYHNPP PHHHPHRPPP PCFPFDPSSL IPSSSTSSPA LTGNNNSFNT  180
SSVSNPNYHN HHHQTLNRAR FMPRFPAKRS MRAPRMRWTT TLHARFVHAV ELLGGHERAT  240
PKSVLELMDV KDLTLAHVKS HLQMYRTVKT TDKAAASSGQ SDVYENGSSG DNNSDDWMFD  300
MNRKSRDSEE LTNPLEKSNG LWTNSSGEAR LHGKLIDNVA EIMLPSEKEL DGKCSSYERI  360
SSEEMSSSSI SGTSPFKPNL EFTLGRSH
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
At.253400.0silique
Expression -- Microarray ? help Back to Top
Source ID E-value
GEO425624600.0
Genevisible245758_at0.0
Expression AtlasAT1G32240-
AtGenExpressAT1G32240-
ATTED-IIAT1G32240-
Expression -- Description ? help Back to Top
Source Description
UniprotTISSUE SPECIFICITY: Expressed in developing phloem. {ECO:0000269|PubMed:14561401}.
Functional Description ? help Back to Top
Source Description
TAIREncodes a member of the KANADI family of putative transcription factors. Together with KAN1, this gene appears to be involved in the development of the carpel and the outer integument of the ovule.Along with KAN1 and KAN4 appears to regulate the proper localization of PIN1 in early embryogenesis.
UniProtProbable transcription factor that regulates lateral organ polarity. Promotes abaxial cell fate during lateral organd formation. Functions with KAN1 in the specification of polarity of the ovule outer integument. {ECO:0000269|PubMed:11525739, ECO:0000269|PubMed:15286295, ECO:0000269|PubMed:16623911, ECO:0000269|PubMed:17307928}.
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00174DAP27203113Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMapAT1G32240.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Regulation -- ATRM (Manually Curated Upstream Regulators) ? help Back to Top
Source Upstream Regulator (A: Activate/R: Repress)
ATRM AT1G65620 (R), AT2G37630 (R)
Phenotype -- Mutation ? help Back to Top
Source ID
T-DNA ExpressAT1G32240
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankBT0292110.0BT029211.1 Arabidopsis thaliana At1g32240 mRNA, complete cds.
GenBankAY0486890.0AY048689.1 Arabidopsis thaliana GARP-like putative transcription factor KANADI2 (KAN2) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_564392.10.0probable transcription factor KAN2
SwissprotQ9C6160.0KAN2_ARATH; Probable transcription factor KAN2
TrEMBLD7KHH90.0D7KHH9_ARALL; Putative uncharacterized protein
STRINGAT1G32240.10.0(Arabidopsis thaliana)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM53872850
Representative plantOGRP5701580
Publications ? help Back to Top
  1. Riechmann JL, et al.
    Arabidopsis transcription factors: genome-wide comparative analysis among eukaryotes.
    Science, 2000. 290(5499): p. 2105-10
    [PMID:11118137]
  2. Eshed Y,Baum SF,Perea JV,Bowman JL
    Establishment of polarity in lateral organs of plants.
    Curr. Biol., 2001. 11(16): p. 1251-60
    [PMID:11525739]
  3. Lin WC,Shuai B,Springer PS
    The Arabidopsis LATERAL ORGAN BOUNDARIES-domain gene ASYMMETRIC LEAVES2 functions in the repression of KNOX gene expression and in adaxial-abaxial patterning.
    Plant Cell, 2003. 15(10): p. 2241-52
    [PMID:14508003]
  4. Emery JF, et al.
    Radial patterning of Arabidopsis shoots by class III HD-ZIP and KANADI genes.
    Curr. Biol., 2003. 13(20): p. 1768-74
    [PMID:14561401]
  5. Hawker NP,Bowman JL
    Roles for Class III HD-Zip and KANADI genes in Arabidopsis root development.
    Plant Physiol., 2004. 135(4): p. 2261-70
    [PMID:15286295]
  6. McAbee JM, et al.
    ABERRANT TESTA SHAPE encodes a KANADI family member, linking polarity determination to separation and growth of Arabidopsis ovule integuments.
    Plant J., 2006. 46(3): p. 522-31
    [PMID:16623911]
  7. Izhaki A,Bowman JL
    KANADI and class III HD-Zip gene families regulate embryo patterning and modulate auxin flow during embryogenesis in Arabidopsis.
    Plant Cell, 2007. 19(2): p. 495-508
    [PMID:17307928]
  8. Iwakawa H, et al.
    Expression of the ASYMMETRIC LEAVES2 gene in the adaxial domain of Arabidopsis leaves represses cell proliferation in this domain and is critical for the development of properly expanded leaves.
    Plant J., 2007. 51(2): p. 173-84
    [PMID:17559509]
  9. Ha CM,Jun JH,Nam HG,Fletcher JC
    BLADE-ON-PETIOLE 1 and 2 control Arabidopsis lateral organ fate through regulation of LOB domain and adaxial-abaxial polarity genes.
    Plant Cell, 2007. 19(6): p. 1809-25
    [PMID:17601823]
  10. Wu G, et al.
    KANADI1 regulates adaxial-abaxial polarity in Arabidopsis by directly repressing the transcription of ASYMMETRIC LEAVES2.
    Proc. Natl. Acad. Sci. U.S.A., 2008. 105(42): p. 16392-7
    [PMID:18849474]
  11. Pires HR,Monfared MM,Shemyakina EA,Fletcher JC
    ULTRAPETALA trxG genes interact with KANADI transcription factor genes to regulate Arabidopsis gynoecium patterning.
    Plant Cell, 2014. 26(11): p. 4345-61
    [PMID:25381352]
  12. Jin J, et al.
    An Arabidopsis Transcriptional Regulatory Map Reveals Distinct Functional and Evolutionary Features of Novel Transcription Factors.
    Mol. Biol. Evol., 2015. 32(7): p. 1767-73
    [PMID:25750178]