PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID AT1G31640.1
Common NameAGL92, F27M3.16
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis
Family M-type_MADS
Protein Properties Length: 464aa    MW: 52211.5 Da    PI: 6.1891
Description AGAMOUS-like 92
Gene Model
Gene Model ID Type Source Coding Sequence
AT1G31640.1genomeTAIRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF37.72.7e-121350643
                 HHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TT CS
       SRF-TF  6 ksnrqvtfskRrngilKKAeELSvLCdaevaviifsst 43
                    r  tf kR +gi KK +EL +LCd++++ +i+s+ 
  AT1G31640.1 13 RHFRRATFRKRNAGIRKKLHELTTLCDIKACAVIYSPF 50
                 566899******************************85 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM004328.2E-11159IPR002100Transcription factor, MADS-box
CDDcd002661.05E-30183No hitNo description
PROSITE profilePS5006614.227148IPR002100Transcription factor, MADS-box
SuperFamilySSF554551.31E-21293IPR002100Transcription factor, MADS-box
PRINTSPR004044.5E-6222IPR002100Transcription factor, MADS-box
PfamPF003191.1E-111156IPR002100Transcription factor, MADS-box
PRINTSPR004044.5E-62237IPR002100Transcription factor, MADS-box
PRINTSPR004044.5E-63758IPR002100Transcription factor, MADS-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 464 aa     Download sequence    Send to blast
MRTKTKLVLI PDRHFRRATF RKRNAGIRKK LHELTTLCDI KACAVIYSPF ENPTVWPSTE  60
GVQEVISEFM EKPATERSKT MMSHETFLRD QITKEQNKLE SLRRENRETQ LKHFMFDCVG  120
GKMSEQQYGA RDLQDLSLFT DQYLNQLNAR KKFLTEYGES SSSVPPLFDV AGANPPVVAD  180
QAAVTVPPLF AVAGANLPVV ADQAAVTVPP LFAVAGANLP VVADQAAVNV PTGFHNMNVN  240
QNQYEPVQPY VPTGFSDHIQ YQNMNFNQNQ QEPVHYQALA VAGAGLPMTQ NQYEPVHYQS  300
LAVAGGGLPM SQLQYEPVQP YIPTVFSDNV QYQHMNLYQN QQEPVHYQAL GVAGAGLPMN  360
QNQYEPVQPY VPTGFSDHFQ FENMNLNQNQ QEPVQYQAPV DFNHQIQQGN YDMNLNQNMK  420
HAHIPFMDGN YYNYHQPPTV GLTSTGHMPS TTTTTTNNNN NNNV
Expression -- Microarray ? help Back to Top
Source ID E-value
GEO183980500.0
Genevisible246577_at0.0
Expression AtlasAT1G31640-
AtGenExpressAT1G31640-
ATTED-IIAT1G31640-
Functional Description ? help Back to Top
Source Description
UniProtPutative transcription factor.
Function -- GeneRIF ? help Back to Top
  1. Studies indicate that AGL36 and AGL92 showed imprinted gene expression.
    [PMID: 24039992]
Cis-element ? help Back to Top
SourceLink
PlantRegMapAT1G31640.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Interaction ? help Back to Top
Source Intact With
BioGRIDAT1G65360, AT1G69120
IntActSearch Q9C6V4
Phenotype -- Mutation ? help Back to Top
Source ID
T-DNA ExpressAT1G31640
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC0743600.0AC074360.5 Arabidopsis thaliana chromosome 1 BAC F27M3 genomic sequence, complete sequence.
GenBankCP0026840.0CP002684.1 Arabidopsis thaliana chromosome 1 sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_174445.10.0AGAMOUS-like 92
SwissprotQ9C6V40.0AGL92_ARATH; Agamous-like MADS-box protein AGL92
TrEMBLA0A178W3Z20.0A0A178W3Z2_ARATH; AGL92
STRINGAT1G31640.10.0(Arabidopsis thaliana)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM7028415
Representative plantOGRP11413173
Publications ? help Back to Top
  1. Riechmann JL, et al.
    Arabidopsis transcription factors: genome-wide comparative analysis among eukaryotes.
    Science, 2000. 290(5499): p. 2105-10
    [PMID:11118137]
  2. De Bodt S, et al.
    Genomewide structural annotation and evolutionary analysis of the type I MADS-box genes in plants.
    J. Mol. Evol., 2003. 56(5): p. 573-86
    [PMID:12698294]
  3. Parenicov√° L, et al.
    Molecular and phylogenetic analyses of the complete MADS-box transcription factor family in Arabidopsis: new openings to the MADS world.
    Plant Cell, 2003. 15(7): p. 1538-51
    [PMID:12837945]
  4. Kofuji R, et al.
    Evolution and divergence of the MADS-box gene family based on genome-wide expression analyses.
    Mol. Biol. Evol., 2003. 20(12): p. 1963-77
    [PMID:12949148]
  5. de Folter S, et al.
    Comprehensive interaction map of the Arabidopsis MADS Box transcription factors.
    Plant Cell, 2005. 17(5): p. 1424-33
    [PMID:15805477]
  6. Zhao J, et al.
    Analysis of gene expression profiles in response to Sclerotinia sclerotiorum in Brassica napus.
    Planta, 2007. 227(1): p. 13-24
    [PMID:17665211]
  7. Hsieh TF, et al.
    Regulation of imprinted gene expression in Arabidopsis endosperm.
    Proc. Natl. Acad. Sci. U.S.A., 2011. 108(5): p. 1755-62
    [PMID:21257907]
  8. Efroni I, et al.
    Regulation of leaf maturation by chromatin-mediated modulation of cytokinin responses.
    Dev. Cell, 2013. 24(4): p. 438-45
    [PMID:23449474]
  9. Yoshida T,Kawabe A
    Importance of gene duplication in the evolution of genomic imprinting revealed by molecular evolutionary analysis of the type I MADS-box gene family in Arabidopsis species.
    PLoS ONE, 2013. 8(9): p. e73588
    [PMID:24039992]
  10. Zhang S, et al.
    FERTILIZATION-INDEPENDENT SEED-Polycomb Repressive Complex 2 Plays a Dual Role in Regulating Type I MADS-Box Genes in Early Endosperm Development.
    Plant Physiol., 2018. 177(1): p. 285-299
    [PMID:29523711]