PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID AT1G31630.1
Common NameAGL86, F27M3.17
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis
Family M-type_MADS
Protein Properties Length: 339aa    MW: 36941.7 Da    PI: 6.6479
Description AGAMOUS-like 86
Gene Model
Gene Model ID Type Source Coding Sequence
AT1G31630.1genomeTAIRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF39.47.8e-131051344
                 --SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTS CS
       SRF-TF  3 ienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstg 44
                 i nk+ r +tf kR+ gi  K +EL +LC+++++ +i s+  
  AT1G31630.1 10 IANKTSRRTTFRKRKGGITNKLHELTTLCGVKACAVISSPYE 51
                 89***********************************99865 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5006615.404148IPR002100Transcription factor, MADS-box
CDDcd002661.68E-29183No hitNo description
SMARTSM004322.0E-14159IPR002100Transcription factor, MADS-box
SuperFamilySSF554553.92E-22293IPR002100Transcription factor, MADS-box
PRINTSPR004041.4E-7222IPR002100Transcription factor, MADS-box
PfamPF003195.8E-141056IPR002100Transcription factor, MADS-box
PRINTSPR004041.4E-72237IPR002100Transcription factor, MADS-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0046983Molecular Functionprotein dimerization activity
Plant Ontology ? help Back to Top
PO Term PO Category PO Description
PO:0009001anatomyfruit
PO:0009062anatomygynoecium
PO:0009089anatomyendosperm
PO:0020093anatomyantipodal cell
PO:0025034anatomyleaf
Sequence ? help Back to Top
Protein Sequence    Length: 339 aa     Download sequence    Send to blast
MRSKIKLSLI ANKTSRRTTF RKRKGGITNK LHELTTLCGV KACAVISSPY ENPVVWPSTE  60
GVQEAVSMFM ERPATEQSKL MMSHETYLQD KITKETKKLE SLRRENRESQ LRQFMFDCVE  120
GKMSEHQYGA RDLQDLSLYI DHYINQLNSS VMLLTNNGAS SSSFPPPLHT SVAGAGAGAG  180
AAPLVVAGAG AAPLAVAGAG ASPLAVAGVG AAPLAVAGAG PPMAQNQYEP IQPYIPTAFS  240
DNIQYQAPVD FNHQIQHGIY DNLSLDPNHQ YPFQDDPFME MLMEYPYEQV GYAAEHAHIP  300
FMNGNYYNYH QPPTVGLTTT GHMPSNNATT TTTTNTTVV
Expression -- Microarray ? help Back to Top
Source ID E-value
GEO183980400.0
Genevisible246578_at0.0
Expression AtlasAT1G31630-
AtGenExpressAT1G31630-
ATTED-IIAT1G31630-
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription factor.
Cis-element ? help Back to Top
SourceLink
PlantRegMapAT1G31630.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Interaction ? help Back to Top
Source Intact With
BioGRIDAT1G65360, AT1G69120
IntActSearch Q9C6V3
Phenotype -- Mutation ? help Back to Top
Source ID
T-DNA ExpressAT1G31630
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC0743600.0AC074360.5 Arabidopsis thaliana chromosome 1 BAC F27M3 genomic sequence, complete sequence.
GenBankCP0026840.0CP002684.1 Arabidopsis thaliana chromosome 1 sequence.
GenBankDQ0564730.0DQ056473.1 Arabidopsis thaliana MADS-box family protein (At1g31630) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_174444.10.0AGAMOUS-like 86
SwissprotQ9C6V30.0AGL86_ARATH; Agamous-like MADS-box protein AGL86
TrEMBLA0A178W8T20.0A0A178W8T2_ARATH; AGL86
STRINGAT1G31630.10.0(Arabidopsis thaliana)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM7028415
Representative plantOGRP11413173
Publications ? help Back to Top
  1. Riechmann JL, et al.
    Arabidopsis transcription factors: genome-wide comparative analysis among eukaryotes.
    Science, 2000. 290(5499): p. 2105-10
    [PMID:11118137]
  2. De Bodt S, et al.
    Genomewide structural annotation and evolutionary analysis of the type I MADS-box genes in plants.
    J. Mol. Evol., 2003. 56(5): p. 573-86
    [PMID:12698294]
  3. Parenicov√° L, et al.
    Molecular and phylogenetic analyses of the complete MADS-box transcription factor family in Arabidopsis: new openings to the MADS world.
    Plant Cell, 2003. 15(7): p. 1538-51
    [PMID:12837945]
  4. Kofuji R, et al.
    Evolution and divergence of the MADS-box gene family based on genome-wide expression analyses.
    Mol. Biol. Evol., 2003. 20(12): p. 1963-77
    [PMID:12949148]
  5. de Folter S, et al.
    Comprehensive interaction map of the Arabidopsis MADS Box transcription factors.
    Plant Cell, 2005. 17(5): p. 1424-33
    [PMID:15805477]
  6. Bemer M,Wolters-Arts M,Grossniklaus U,Angenent GC
    The MADS domain protein DIANA acts together with AGAMOUS-LIKE80 to specify the central cell in Arabidopsis ovules.
    Plant Cell, 2008. 20(8): p. 2088-101
    [PMID:18713950]
  7. Day RC,Herridge RP,Ambrose BA,Macknight RC
    Transcriptome analysis of proliferating Arabidopsis endosperm reveals biological implications for the control of syncytial division, cytokinin signaling, and gene expression regulation.
    Plant Physiol., 2008. 148(4): p. 1964-84
    [PMID:18923020]
  8. Bemer M,Heijmans K,Airoldi C,Davies B,Angenent GC
    An atlas of type I MADS box gene expression during female gametophyte and seed development in Arabidopsis.
    Plant Physiol., 2010. 154(1): p. 287-300
    [PMID:20631316]
  9. Mar
    Large-scale identification of gibberellin-related transcription factors defines group VII ETHYLENE RESPONSE FACTORS as functional DELLA partners.
    Plant Physiol., 2014. 166(2): p. 1022-32
    [PMID:25118255]
  10. Zhang S, et al.
    FERTILIZATION-INDEPENDENT SEED-Polycomb Repressive Complex 2 Plays a Dual Role in Regulating Type I MADS-Box Genes in Early Endosperm Development.
    Plant Physiol., 2018. 177(1): p. 285-299
    [PMID:29523711]