PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID AT1G29962.1
Common NameAGL64
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis
Family M-type_MADS
Protein Properties Length: 185aa    MW: 21176.3 Da    PI: 9.3641
Description AGAMOUS-like 64
Gene Model
Gene Model ID Type Source Coding Sequence
AT1G29962.1genomeTAIRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF51.21.6e-161564150
                 S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE CS
       SRF-TF  1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeys 50
                 k+ie +  r vt+skRrngi  K +ELS+LC+aeva + +s +gk y++ 
  AT1G29962.1 15 KKIEKDEDRLVTLSKRRNGIYTKLSELSILCGAEVAFLGYSCSGKPYTFG 64
                 689*********************************************95 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM004322.4E-19766IPR002100Transcription factor, MADS-box
SuperFamilySSF554552.88E-22777IPR002100Transcription factor, MADS-box
PROSITE profilePS5006621.824767IPR002100Transcription factor, MADS-box
CDDcd002651.02E-31880No hitNo description
PRINTSPR004047.0E-15929IPR002100Transcription factor, MADS-box
PfamPF003198.3E-191663IPR002100Transcription factor, MADS-box
PRINTSPR004047.0E-152944IPR002100Transcription factor, MADS-box
PRINTSPR004047.0E-154465IPR002100Transcription factor, MADS-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0046983Molecular Functionprotein dimerization activity
Plant Ontology ? help Back to Top
PO Term PO Category PO Description
PO:0009009anatomyplant embryo
PO:0009089anatomyendosperm
PO:0020093anatomyantipodal cell
Sequence ? help Back to Top
Protein Sequence    Length: 185 aa     Download sequence    Send to blast
MKPKKTKGKQ RINIKKIEKD EDRLVTLSKR RNGIYTKLSE LSILCGAEVA FLGYSCSGKP  60
YTFGSPSFQA VAERFLNGEA SSSSSSSLQR SVMNAHQQAK IQELCKVYNR LVEEITVEEV  120
KLKKTAALAE MMPMNEDAWW KVDPNDVKDR EEVKKMMEKH QELYEKLCEE AASRIKRGHD  180
ENNNK
Expression -- Microarray ? help Back to Top
Source ID E-value
Genevisible260050_at0.0
Expression AtlasAT1G29962-
AtGenExpressAT1G29962-
Cis-element ? help Back to Top
SourceLink
PlantRegMapAT1G29962.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Phenotype -- Mutation ? help Back to Top
Source ID
T-DNA ExpressAT1G29962
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC0224550.0AC022455.5 Arabidopsis thaliana chromosome 1 BAC T1P2 genomic sequence, complete sequence.
GenBankAY1412440.0AY141244.1 Arabidopsis thaliana MADS-box protein AGL64 mRNA, complete cds.
GenBankCP0026840.0CP002684.1 Arabidopsis thaliana chromosome 1 sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_001077625.11e-136AGAMOUS-like 64
TrEMBLQ7XJK91e-135Q7XJK9_ARATH; AGAMOUS-like 64
STRINGAT1G29962.11e-135(Arabidopsis thaliana)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM46761352
Representative plantOGRP1617761
Publications ? help Back to Top
  1. Riechmann JL, et al.
    Arabidopsis transcription factors: genome-wide comparative analysis among eukaryotes.
    Science, 2000. 290(5499): p. 2105-10
    [PMID:11118137]
  2. Parenicov√° L, et al.
    Molecular and phylogenetic analyses of the complete MADS-box transcription factor family in Arabidopsis: new openings to the MADS world.
    Plant Cell, 2003. 15(7): p. 1538-51
    [PMID:12837945]
  3. Bemer M,Heijmans K,Airoldi C,Davies B,Angenent GC
    An atlas of type I MADS box gene expression during female gametophyte and seed development in Arabidopsis.
    Plant Physiol., 2010. 154(1): p. 287-300
    [PMID:20631316]