PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID AT1G29860.1
Common NameATWRKY71, F1N18.10, WRKY71
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis
Family WRKY
Protein Properties Length: 282aa    MW: 31955.3 Da    PI: 7.4953
Description WRKY DNA-binding protein 71
Gene Model
Gene Model ID Type Source Coding Sequence
AT1G29860.1genomeTAIRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1WRKY1092.2e-34136193259
                  --SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS- CS
         WRKY   2 dDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhe 59 
                  +Dgy+WrKYGqK vk+s++prsYYrCt+++C+vkk+vers +dp++v++tYeg+Hnh+
  AT1G29860.1 136 EDGYRWRKYGQKAVKNSPYPRSYYRCTTQKCNVKKRVERSFQDPSIVITTYEGKHNHP 193
                  8********************************************************7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PIRSFPIRSF0381302.5E-1012282IPR017396PWRKY transcription factor, group IIc
Gene3DG3DSA:2.20.25.809.8E-36120195IPR003657WRKY domain
SuperFamilySSF1182903.4E-30127195IPR003657WRKY domain
PROSITE profilePS5081133.063130195IPR003657WRKY domain
SMARTSM007743.9E-40135194IPR003657WRKY domain
PfamPF031069.5E-27136193IPR003657WRKY domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Plant Ontology ? help Back to Top
PO Term PO Category PO Description
PO:0009047anatomystem
Sequence ? help Back to Top
Protein Sequence    Length: 282 aa     Download sequence    Send to blast
MDDHVEHNYN TSLEEVHFKS LSDCLQSSLV MDYNSLEKVF KFSPYSSPFQ SVSPSVNNPY  60
LNLTSNSPVV SSSSNEGEPK ENTNDKSDQM EDNEGDLHGV GESSKQLTKQ GKKKGEKKER  120
EVRVAFMTKS EIDHLEDGYR WRKYGQKAVK NSPYPRSYYR CTTQKCNVKK RVERSFQDPS  180
IVITTYEGKH NHPIPSTLRG TVAAEHLLVH RGGGGSLLHS FPRHHQDFLM MKHSPANYQS  240
VGSLSYEHGH GTSSYNFNNN QPVVDYGLLQ DIVPSMFSKN ES
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
2lex_A2e-30125196778Probable WRKY transcription factor 4
1wj2_A2e-30125196778Probable WRKY transcription factor 4
Search in ModeBase
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
At.262810.0root
Expression -- Microarray ? help Back to Top
Source ID E-value
GEO306909390.0
Genevisible255999_at0.0
Expression AtlasAT1G29860-
AtGenExpressAT1G29860-
ATTED-IIAT1G29860-
Functional Description ? help Back to Top
Source Description
TAIRmember of WRKY Transcription Factor; Group II-c
UniProtTranscription factor. Interacts specifically with the W box (5'-(T)TGAC[CT]-3'), a frequently occurring elicitor-responsive cis-acting element (By similarity). {ECO:0000250}.
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00168DAP27203113Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMapAT1G29860.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Phenotype -- Mutation ? help Back to Top
Source ID
T-DNA ExpressAT1G29860
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAF4211580.0AF421158.1 Arabidopsis thaliana WRKY transcription factor 71 (WRKY71) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_174279.10.0putative WRKY transcription factor 71
SwissprotQ93WV40.0WRK71_ARATH; Probable WRKY transcription factor 71
TrEMBLC0SUY30.0C0SUY3_ARATH; Putative uncharacterized protein At1g29860 (Fragment)
STRINGAT1G29860.10.0(Arabidopsis thaliana)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM139111825
Representative plantOGRP1417875
Publications ? help Back to Top
  1. Eulgem T,Rushton PJ,Robatzek S,Somssich IE
    The WRKY superfamily of plant transcription factors.
    Trends Plant Sci., 2000. 5(5): p. 199-206
    [PMID:10785665]
  2. Riechmann JL, et al.
    Arabidopsis transcription factors: genome-wide comparative analysis among eukaryotes.
    Science, 2000. 290(5499): p. 2105-10
    [PMID:11118137]
  3. Ma S,Gong Q,Bohnert HJ
    Dissecting salt stress pathways.
    J. Exp. Bot., 2006. 57(5): p. 1097-107
    [PMID:16510518]
  4. Nicola
    Large-scale analysis of mRNA translation states during sucrose starvation in arabidopsis cells identifies cell proliferation and chromatin structure as targets of translational control.
    Plant Physiol., 2006. 141(2): p. 663-73
    [PMID:16632591]