PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID AT1G28420.1
Common NameHB-1, RLT1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis
Family HB-other
Protein Properties Length: 1705aa    MW: 191990 Da    PI: 5.1341
Description homeobox-1
Gene Model
Gene Model ID Type Source Coding Sequence
AT1G28420.1genomeTAIRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox603.8e-194196257
                 T--SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHHC CS
     Homeobox  2 rkRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakekk 57
                  kR+  t+ qle+Le+++ +++yps+++r+eL++kl+L++rq ++WF+ rR k+kk
  AT1G28420.1 41 PKRQMKTPFQLETLEKVYSEEKYPSEATRAELSEKLDLSDRQLQMWFCHRRLKDKK 96
                 69****************************************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.601.5E-182496IPR009057Homeodomain-like
SuperFamilySSF466891.03E-163196IPR009057Homeodomain-like
PROSITE profilePS5007116.6823797IPR001356Homeobox domain
SMARTSM003891.4E-1739101IPR001356Homeobox domain
PfamPF000469.4E-174196IPR001356Homeobox domain
CDDcd000867.95E-154296No hitNo description
PROSITE profilePS5082717.628549608IPR018501DDT domain
SMARTSM005711.1E-23549608IPR018501DDT domain
PfamPF027913.1E-17550605IPR018501DDT domain
PfamPF050669.0E-16731798IPR007759HB1/Asxl, restriction endonuclease HTH domain
PfamPF156129.0E-7933972IPR028942WHIM1 domain
PfamPF156133.1E-1211001172IPR028941WHIM2 domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009908Biological Processflower development
GO:0010228Biological Processvegetative to reproductive phase transition of meristem
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0005515Molecular Functionprotein binding
Plant Ontology ? help Back to Top
PO Term PO Category PO Description
PO:0000013anatomycauline leaf
PO:0000037anatomyshoot apex
PO:0000230anatomyinflorescence meristem
PO:0000293anatomyguard cell
PO:0008019anatomyleaf lamina base
PO:0009005anatomyroot
PO:0009006anatomyshoot system
PO:0009009anatomyplant embryo
PO:0009010anatomyseed
PO:0009025anatomyvascular leaf
PO:0009029anatomystamen
PO:0009030anatomycarpel
PO:0009031anatomysepal
PO:0009032anatomypetal
PO:0009046anatomyflower
PO:0009047anatomystem
PO:0009052anatomyflower pedicel
PO:0020030anatomycotyledon
PO:0020038anatomypetiole
PO:0020100anatomyhypocotyl
PO:0020137anatomyleaf apex
PO:0025022anatomycollective leaf structure
PO:0025281anatomypollen
PO:0001054developmental stagevascular leaf senescent stage
PO:0001078developmental stageplant embryo cotyledonary stage
PO:0001081developmental stagemature plant embryo stage
PO:0001185developmental stageplant embryo globular stage
PO:0004507developmental stageplant embryo bilateral stage
PO:0007064developmental stageLP.12 twelve leaves visible stage
PO:0007095developmental stageLP.08 eight leaves visible stage
PO:0007098developmental stageLP.02 two leaves visible stage
PO:0007103developmental stageLP.10 ten leaves visible stage
PO:0007115developmental stageLP.04 four leaves visible stage
PO:0007123developmental stageLP.06 six leaves visible stage
PO:0007611developmental stagepetal differentiation and expansion stage
PO:0007616developmental stageflowering stage
Sequence ? help Back to Top
Protein Sequence    Length: 1705 aa     Download sequence    Send to blast
MEMGSDGEDQ KIRSVVGDAN LNNKKKKIDN NSSSKDGRVK PKRQMKTPFQ LETLEKVYSE  60
EKYPSEATRA ELSEKLDLSD RQLQMWFCHR RLKDKKDGQS NKPVKSSVAA VQSASVNELP  120
AAAGSVPEQD SRSDSGSESG CSPYSNSRRN FASGSSSSRA ELDEYETMGK PSYESRLSTM  180
VHRAIVCIEA QLGEPLRDDG PILGMEFDPL PPGAFGTPIA MQKHLLHPYE SDLYERHDPR  240
PRRSHAAARS FHEQQSLDDP SSFTPNMYER YSENHARGMD YEVARSRISS FMHANGPVPR  300
SYVTPGHASR NCSTSQQDMP SPIESAHHGD RFLLEKDSSV LGTEDPYLLP DGVRKSSDVH  360
RKGKINDGRL GRGSETRENH GPKDLEKLEI QRKKNEERMR KEMERNERER RKEEERLMRE  420
RIKEEERLQR EQRREVERRE KFLQRENERA EKKKQKDEIR REKDAIRRKL AIEKATARRI  480
AKESMDLIED EQLELMELAA ISKGLPSVLQ LDHDTLQNLE VYRDSLSTFP PKSLQLKMPF  540
AISPWKDSDE TVGNLLMVWR FLISFSDVLD LWPFTLDEFI QAFHDYDSRL LGEIHVTLLR  600
SIIRDVEDVA RTPFSGIGNN QYTTANPEGG HPQIVEGAYA WGFDIRSWKK HLNPLTWPEI  660
LRQLALSAGF GPKLKKKHSR LTNTGDKDEA KGCEDVISTI RNGTAAESAF ASMREKGLLA  720
PRKSRHRLTP GTVKFAAFHV LSLEGSKGLT VLELADKIQK SGLRDLTTSK TPEASISVAL  780
TRDVKLFERI APSTYCVRAP YVKDPKDGEA ILADARKKIR AFENGFTGPE DVNDLERDED  840
FEIDIDEDPE VDDLATLASA SKSAVLGEAN VLSGKGVDTM FCDVKADVKS ELEKEFSSPP  900
PSTMKSIVPQ HSERHKNTVV GGVDAVIDES NQGQSWIQGL TEGDYCHLSV EERLNALVAL  960
VGIANEGNSI RTGLEDRMEA ANALKKQMWA EAQLDNSCMR DVLKLDLQNL ASSKTESTIG  1020
LPIIQSSTRE RDSFDRDPSQ LLDETKPLED LSNDLHKSSA ERALINQDAN ISQENYASKR  1080
SRSQLKSYIG HKAEEVYPYR SLPLGQDRRH NRYWHFAVSV SKSDPCSRLL FVELHDGKWL  1140
LIDSEEAFDI LVASLDMRGI RESHLRIMLQ KIEGSFKENA CKDIKLARNP FLTEKSVVNH  1200
SPTDSVSPSS SAISGSNSDS METSTSIRVD LGRNDTENKN LSKRFHDFQR WMWTETYSSL  1260
PSCARKYGKK RSELLATCDA CVASYLSEYT FCSSCHQRLD VVDSSEILDS GLAVSPLPFG  1320
VRLLKPLLVF LEASVPDEAL ESFWTEDQRK KWGFRLNTSS SPGELLQVLT SLESAIKKES  1380
LSSNFMSAKE LLGAANAEAD DQGSVDVLPW IPKTVSAVAL RLSELDASII YVKPEKPEVI  1440
PEDENEQISL FPRDSPFKGK GPREQEDQDE VAPNPGNRNK KRARVSLGSG SNRKVKRKKA  1500
QSGLNKFVVG RRNVAVNSNL MAVELNHQVP GKGKRTVRKR PERIDEDNSH LVNRMANIVR  1560
PKSEEVEEDE EEEEQTFRDI NEDWAAGETP REMEEDWANE TPNRMMTPMQ VDDESDNSVG  1620
VESEDEDGGG QFVDYSQRNK WGLDWNSNLN VAIEEDEEEE VVGVGRVEGE DDAEMSESSE  1680
DDDVPANNAA NNYDRESEGY SSSDS
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
13644GRVKPKRQM
28996RRLKDKKD
314791498KKRARVSLGSGSNRKVKRKK
414911498NRKVKRKK
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
At.277880.0flower| root
Expression -- Microarray ? help Back to Top
Source ID E-value
GEO1864789590.0
Genevisible261494_at0.0
Expression AtlasAT1G28420-
AtGenExpressAT1G28420-
ATTED-IIAT1G28420-
Expression -- Description ? help Back to Top
Source Description
UniprotTISSUE SPECIFICITY: Highly expressed in growing tissues such as inflorescence and flower meristems, young leaves and floral organs. Expressed in roots, rosette and cauline leaves, stems, flowers, inflorescences and siliques. {ECO:0000269|PubMed:22694359}.
Functional Description ? help Back to Top
Source Description
UniProtTranscriptional regulator required for the maintenance of the plant vegetative phase. In association with CHR11 or CHR17 may prevent the early activation of the vegetative-to-reproductive transition by regulating key genes that contribute to flower timing, such as FT, SEP1, SEP3, AGL8/FUL, SOC1 and FLC. {ECO:0000269|PubMed:22694359}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapAT1G28420.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Phenotype -- Disruption Phenotype ? help Back to Top
Source Description
UniProtDISRUPTION PHENOTYPE: No visible phenotype under normal growth conditions, but the double mutant plants rlt-1 and rlt2-1 are small and display early flowering. {ECO:0000269|PubMed:22694359}.
Phenotype -- Mutation ? help Back to Top
Source ID
T-DNA ExpressAT1G28420
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC0101550.0AC010155.3 Genomic sequence for Arabidopsis thaliana BAC F3M18 from chromosome I, complete sequence.
GenBankCP0026840.0CP002684.1 Arabidopsis thaliana chromosome 1 sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_174164.20.0homeobox-1
SwissprotF4HY560.0RLT1_ARATH; Homeobox-DDT domain protein RLT1
TrEMBLA0A178WG940.0A0A178WG94_ARATH; RLT1
STRINGAT1G28420.10.0(Arabidopsis thaliana)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM83472236
Representative plantOGRP15771634
Publications ? help Back to Top
  1. Riechmann JL, et al.
    Arabidopsis transcription factors: genome-wide comparative analysis among eukaryotes.
    Science, 2000. 290(5499): p. 2105-10
    [PMID:11118137]
  2. Ma L, et al.
    Genomic evidence for COP1 as a repressor of light-regulated gene expression and development in Arabidopsis.
    Plant Cell, 2002. 14(10): p. 2383-98
    [PMID:12368493]
  3. Son O, et al.
    Induction of a homeodomain-leucine zipper gene by auxin is inhibited by cytokinin in Arabidopsis roots.
    Biochem. Biophys. Res. Commun., 2005. 326(1): p. 203-9
    [PMID:15567172]
  4. Li G, et al.
    Imitation Switch chromatin remodeling factors and their interacting RINGLET proteins act together in controlling the plant vegetative phase in Arabidopsis.
    Plant J., 2012. 72(2): p. 261-70
    [PMID:22694359]
  5. Efroni I, et al.
    Regulation of leaf maturation by chromatin-mediated modulation of cytokinin responses.
    Dev. Cell, 2013. 24(4): p. 438-45
    [PMID:23449474]
  6. Dong J, et al.
    SLIDE, the protein interacting domain of Imitation Switch remodelers, binds DDT-domain proteins of different subfamilies in chromatin remodeling complexes.
    J Integr Plant Biol, 2013. 55(10): p. 928-37
    [PMID:23691993]
  7. Waidmann S,Kusenda B,Mayerhofer J,Mechtler K,Jonak C
    A DEK domain-containing protein modulates chromatin structure and function in Arabidopsis.
    Plant Cell, 2014. 26(11): p. 4328-44
    [PMID:25387881]