PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID AT1G28050.1
Common NameBBX13, COL15, F13K9.15
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis
Family CO-like
Protein Properties Length: 433aa    MW: 47605.9 Da    PI: 5.978
Description B-box type zinc finger protein with CCT domain
Gene Model
Gene Model ID Type Source Coding Sequence
AT1G28050.1genomeTAIRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-B_box18.83.3e-06646337
     zf-B_box  3 erkCpeHeekelqlfCedCqqllCedClleeHkg......H 37
                    C+ ++e  + lfC+ +   lC  C ++ H        H
  AT1G28050.1  6 RVPCDFCGERTAVLFCRADTAKLCLPCDQQVHTAnllsrkH 46
                 678*******9*******************99444555555 PP

2zf-B_box21.64.5e-074980334
     zf-B_box  3 erkCpeHeekelqlfCedCqqllCedClleeH 34
                  ++C+++++++++  C++++  lC++C    H
  AT1G28050.1 49 SQICDNCGNEPVSVRCFTDNLILCQECDWDVH 80
                 689************************98777 PP

3CCT64.92.3e-22385429145
          CCT   1 ReaallRYkeKrktRkFeKkirYesRKavAesRpRvKGrFvkqae 45 
                  R  a++RYkeKrktR+++K+irYesRKa+A++R Rv+GrFvk++e
  AT1G28050.1 385 RGDAMQRYKEKRKTRRYDKTIRYESRKARADTRLRVRGRFVKASE 429
                  6789**************************************975 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS501199.741451IPR000315B-box-type zinc finger
SMARTSM003361.1E-13451IPR000315B-box-type zinc finger
CDDcd000218.33E-9751No hitNo description
PROSITE profilePS501198.6034794IPR000315B-box-type zinc finger
CDDcd000215.21E-85180No hitNo description
SMARTSM003360.835294IPR000315B-box-type zinc finger
PROSITE profilePS5101714.922385427IPR010402CCT domain
PfamPF062031.1E-16385427IPR010402CCT domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0005515Molecular Functionprotein binding
GO:0008270Molecular Functionzinc ion binding
Plant Ontology ? help Back to Top
PO Term PO Category PO Description
PO:0000013anatomycauline leaf
PO:0000037anatomyshoot apex
PO:0000230anatomyinflorescence meristem
PO:0000293anatomyguard cell
PO:0008019anatomyleaf lamina base
PO:0009005anatomyroot
PO:0009009anatomyplant embryo
PO:0009010anatomyseed
PO:0009025anatomyvascular leaf
PO:0009029anatomystamen
PO:0009030anatomycarpel
PO:0009031anatomysepal
PO:0009032anatomypetal
PO:0009046anatomyflower
PO:0009047anatomystem
PO:0009052anatomyflower pedicel
PO:0020030anatomycotyledon
PO:0020038anatomypetiole
PO:0020100anatomyhypocotyl
PO:0020137anatomyleaf apex
PO:0025022anatomycollective leaf structure
PO:0025281anatomypollen
PO:0001054developmental stagevascular leaf senescent stage
PO:0001078developmental stageplant embryo cotyledonary stage
PO:0001081developmental stagemature plant embryo stage
PO:0001185developmental stageplant embryo globular stage
PO:0004507developmental stageplant embryo bilateral stage
PO:0007064developmental stageLP.12 twelve leaves visible stage
PO:0007095developmental stageLP.08 eight leaves visible stage
PO:0007098developmental stageLP.02 two leaves visible stage
PO:0007103developmental stageLP.10 ten leaves visible stage
PO:0007115developmental stageLP.04 four leaves visible stage
PO:0007123developmental stageLP.06 six leaves visible stage
PO:0007611developmental stagepetal differentiation and expansion stage
PO:0007616developmental stageflowering stage
Sequence ? help Back to Top
Protein Sequence    Length: 433 aa     Download sequence    Send to blast
MSSSERVPCD FCGERTAVLF CRADTAKLCL PCDQQVHTAN LLSRKHVRSQ ICDNCGNEPV  60
SVRCFTDNLI LCQECDWDVH GSCSVSDAHV RSAVEGFSGC PSALELAALW GLDLEQGRKD  120
EENQVPMMAM MMDNFGMQLD SWVLGSNELI VPSDTTFKKR GSCGSSCGRY KQVLCKQLEE  180
LLKSGVVGGD GDDGDRDRDC DREGACDGDG DGEAGEGLMV PEMSERLKWS RDVEEINGGG  240
GGGVNQQWNA TTTNPSGGQS SQIWDFNLGQ SRGPEDTSRV EAAYVGKGAA SSFTINNFVD  300
HMNETCSTNV KGVKEIKKDD YKRSTSGQVQ PTKSESNNRP ITFGSEKGSN SSSDLHFTEH  360
IAGTSCKTTR LVATKADLER LAQNRGDAMQ RYKEKRKTRR YDKTIRYESR KARADTRLRV  420
RGRFVKASEA PYP
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
At.197540.0flower| root| silique| vegetative tissue
Expression -- Microarray ? help Back to Top
Source ID E-value
GEO425623630.0
Genevisible259595_at0.0
Expression AtlasAT1G28050-
AtGenExpressAT1G28050-
ATTED-IIAT1G28050-
Cis-element ? help Back to Top
SourceLink
PlantRegMapAT1G28050.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Interaction ? help Back to Top
Source Intact With
BioGRIDAT1G56170
IntActSearch Q9C7E8
Phenotype -- Mutation ? help Back to Top
Source ID
T-DNA ExpressAT1G28050
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAY0372060.0AY037206.1 Arabidopsis thaliana At1g28050/F13K9_15 mRNA, complete cds.
GenBankBT0026810.0BT002681.1 Arabidopsis thaliana At1g28050/F13K9_15 gene, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_174126.10.0B-box type zinc finger protein with CCT domain-containing protein
SwissprotQ9C7E80.0COL15_ARATH; Zinc finger protein CONSTANS-LIKE 15
TrEMBLA0A178WG250.0A0A178WG25_ARATH; BBX13
STRINGAT1G28050.10.0(Arabidopsis thaliana)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM38712647
Representative plantOGRP5453813
Publications ? help Back to Top
  1. Riechmann JL, et al.
    Arabidopsis transcription factors: genome-wide comparative analysis among eukaryotes.
    Science, 2000. 290(5499): p. 2105-10
    [PMID:11118137]
  2. Robson F, et al.
    Functional importance of conserved domains in the flowering-time gene CONSTANS demonstrated by analysis of mutant alleles and transgenic plants.
    Plant J., 2001. 28(6): p. 619-31
    [PMID:11851908]
  3. Griffiths S,Dunford RP,Coupland G,Laurie DA
    The evolution of CONSTANS-like gene families in barley, rice, and Arabidopsis.
    Plant Physiol., 2003. 131(4): p. 1855-67
    [PMID:12692345]
  4. Yamada K, et al.
    Empirical analysis of transcriptional activity in the Arabidopsis genome.
    Science, 2003. 302(5646): p. 842-6
    [PMID:14593172]
  5. S
    ABA activates ADPR cyclase and cADPR induces a subset of ABA-responsive genes in Arabidopsis.
    Plant J., 2004. 38(3): p. 381-95
    [PMID:15086800]
  6. Fukamatsu Y, et al.
    Identification of LOV KELCH PROTEIN2 (LKP2)-interacting factors that can recruit LKP2 to nuclear bodies.
    Plant Cell Physiol., 2005. 46(8): p. 1340-9
    [PMID:15937324]
  7. Wenkel S, et al.
    CONSTANS and the CCAAT box binding complex share a functionally important domain and interact to regulate flowering of Arabidopsis.
    Plant Cell, 2006. 18(11): p. 2971-84
    [PMID:17138697]
  8. Khanna R, et al.
    The Arabidopsis B-box zinc finger family.
    Plant Cell, 2009. 21(11): p. 3416-20
    [PMID:19920209]
  9. Hanada K, et al.
    Functional compensation of primary and secondary metabolites by duplicate genes in Arabidopsis thaliana.
    Mol. Biol. Evol., 2011. 28(1): p. 377-82
    [PMID:20736450]
  10. Arabidopsis Interactome Mapping Consortium
    Evidence for network evolution in an Arabidopsis interactome map.
    Science, 2011. 333(6042): p. 601-7
    [PMID:21798944]
  11. Kim MH,Sonoda Y,Sasaki K,Kaminaka H,Imai R
    Interactome analysis reveals versatile functions of Arabidopsis COLD SHOCK DOMAIN PROTEIN 3 in RNA processing within the nucleus and cytoplasm.
    Cell Stress Chaperones, 2013. 18(4): p. 517-25
    [PMID:23334891]
  12. Efroni I, et al.
    Regulation of leaf maturation by chromatin-mediated modulation of cytokinin responses.
    Dev. Cell, 2013. 24(4): p. 438-45
    [PMID:23449474]
  13. Ding Y, et al.
    Four distinct types of dehydration stress memory genes in Arabidopsis thaliana.
    BMC Plant Biol., 2013. 13: p. 229
    [PMID:24377444]