PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID AT1G27370.4
Common NameF17L21.15, SPL10
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis
Family SBP
Protein Properties Length: 396aa    MW: 44159.1 Da    PI: 7.8702
Description squamosa promoter binding protein-like 10
Gene Model
Gene Model ID Type Source Coding Sequence
AT1G27370.4genomeTAIRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SBP128.23.2e-40175251177
                  --SSTT-----TT--HHHHHTT--HHHHT-S-EEETTEEEEE-TTTSSEEETTT--SS--S-STTTT-------S-- CS
          SBP   1 lCqvegCeadlseakeyhrrhkvCevhskapvvlvsgleqrfCqqCsrfhelsefDeekrsCrrrLakhnerrrkkq 77 
                  +Cq++gCe dls+ k+yhr+h+vCe+hsk+p+v+vsgle+rfCqqCsrfh++sefDe+krsCr+rL++hn+rrrk+q
  AT1G27370.4 175 RCQIDGCELDLSSSKDYHRKHRVCETHSKCPKVVVSGLERRFCQQCSRFHAVSEFDEKKRSCRKRLSHHNARRRKPQ 251
                  6**************************************************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:4.10.1100.106.8E-33168237IPR004333Transcription factor, SBP-box
PROSITE profilePS5114132.402173250IPR004333Transcription factor, SBP-box
SuperFamilySSF1036121.7E-37174251IPR004333Transcription factor, SBP-box
PfamPF031109.5E-31176249IPR004333Transcription factor, SBP-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0010358Biological Processleaf shaping
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:0048510Biological Processregulation of timing of transition from vegetative to reproductive phase
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0046872Molecular Functionmetal ion binding
Plant Ontology ? help Back to Top
PO Term PO Category PO Description
PO:0000013anatomycauline leaf
PO:0000014anatomyrosette leaf
PO:0000037anatomyshoot apex
PO:0000230anatomyinflorescence meristem
PO:0000293anatomyguard cell
PO:0008019anatomyleaf lamina base
PO:0009005anatomyroot
PO:0009006anatomyshoot system
PO:0009009anatomyplant embryo
PO:0009010anatomyseed
PO:0009025anatomyvascular leaf
PO:0009029anatomystamen
PO:0009030anatomycarpel
PO:0009031anatomysepal
PO:0009032anatomypetal
PO:0009046anatomyflower
PO:0009047anatomystem
PO:0009049anatomyinflorescence
PO:0009052anatomyflower pedicel
PO:0020030anatomycotyledon
PO:0020038anatomypetiole
PO:0020100anatomyhypocotyl
PO:0020137anatomyleaf apex
PO:0025022anatomycollective leaf structure
PO:0025281anatomypollen
PO:0001054developmental stagevascular leaf senescent stage
PO:0001078developmental stageplant embryo cotyledonary stage
PO:0001081developmental stagemature plant embryo stage
PO:0001185developmental stageplant embryo globular stage
PO:0004507developmental stageplant embryo bilateral stage
PO:0007064developmental stageLP.12 twelve leaves visible stage
PO:0007095developmental stageLP.08 eight leaves visible stage
PO:0007098developmental stageLP.02 two leaves visible stage
PO:0007103developmental stageLP.10 ten leaves visible stage
PO:0007115developmental stageLP.04 four leaves visible stage
PO:0007123developmental stageLP.06 six leaves visible stage
PO:0007611developmental stagepetal differentiation and expansion stage
PO:0007616developmental stageflowering stage
Sequence ? help Back to Top
Protein Sequence    Length: 396 aa     Download sequence    Send to blast
MDCNMVSSFP WDWENLIMSN QSKTENEKKQ QSTEWEFEKG EGIESIVPDF LGFEKVSSGS  60
ATSFWHTAVS KSSQSTSINS SSPEDKRCNL ASQSSPGDSS SNIDFLQVKP STALEVPIAS  120
AESDLCLKLG KRTYSEEFWG RNNNDLSAVS MNLLTPSVVA RKKTKSCGQS MQVPRCQIDG  180
CELDLSSSKD YHRKHRVCET HSKCPKVVVS GLERRFCQQC SRFHAVSEFD EKKRSCRKRL  240
SHHNARRRKP QGVFPLNSER VFDRRQHTSM LWNGLSLNTR SEEKYTWGTT YETKPTQMES  300
GFTLSFQRGN GSEDQLFTGS TLSFSAFQTS GGFSAGKSNI QLPDKGVGEC SGGLHESHDF  360
YSALSLLSTT SDSQGIKHTP VAEPPPIFGT FPSHFI
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ul4_A8e-271762491184squamosa promoter binding protein-like 4
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1231248KKRSCRKRLSHHNARRRK
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
At.219700.0flower
Expression -- Microarray ? help Back to Top
Source ID E-value
GEO306898740.0
Genevisible264489_at0.0
Expression AtlasAT1G27370-
AtGenExpressAT1G27370-
ATTED-IIAT1G27370-
Expression -- Description ? help Back to Top
Source Description
UniprotDEVELOPMENTAL STAGE: Expressed constitutively during plant development, weak increase during flowering. {ECO:0000269|PubMed:10524240, ECO:0000269|PubMed:14573523}.
Functional Description ? help Back to Top
Source Description
TAIRIn conjunction with SPL11 and SPL2, SPL10 redundantly controls proper development of lateral organs in association with shoot maturation in the reproductive phase. SPL10 also controls lamina shape during vegetative development.
UniProtTrans-acting factor that binds specifically to the consensus nucleotide sequence 5'-TNCGTACAA-3'. {ECO:0000250}.
Function -- GeneRIF ? help Back to Top
  1. SPL10, SPL11 and SPL2 regulate morphological traits of cauline leaves and flowers, and control shoot maturation not only in the vegetative phase but also in the reproductive phase.
    [PMID: 19880401]
Cis-element ? help Back to Top
SourceLink
PlantRegMapAT1G27370.4
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: Negatively regulated by microRNAs miR156 and miR157. {ECO:0000305|PubMed:12202040}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Phenotype -- Mutation ? help Back to Top
Source ID
T-DNA ExpressAT1G27370
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAY1420280.0AY142028.1 Arabidopsis thaliana At1g27370/F17L21_16 mRNA, complete cds.
GenBankAJ0116370.0AJ011637.1 Arabidopsis thaliana (ecotype Columbia) mRNA for squamosa promoter binding protein-like 10.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_001031096.20.0squamosa promoter-binding-like protein 10
RefseqNP_001077605.10.0squamosa promoter-binding-like protein 10
RefseqNP_174057.20.0squamosa promoter-binding-like protein 10
RefseqNP_973921.10.0squamosa promoter-binding-like protein 10
SwissprotQ8S9L00.0SPL10_ARATH; Squamosa promoter-binding-like protein 10
TrEMBLD7KBP40.0D7KBP4_ARALL; Putative uncharacterized protein
STRINGAT1G27370.10.0(Arabidopsis thaliana)
Publications ? help Back to Top
  1. Cardon G, et al.
    Molecular characterisation of the Arabidopsis SBP-box genes.
    Gene, 1999. 237(1): p. 91-104
    [PMID:10524240]
  2. Riechmann JL, et al.
    Arabidopsis transcription factors: genome-wide comparative analysis among eukaryotes.
    Science, 2000. 290(5499): p. 2105-10
    [PMID:11118137]
  3. Rhoades MW, et al.
    Prediction of plant microRNA targets.
    Cell, 2002. 110(4): p. 513-20
    [PMID:12202040]
  4. Schmid M, et al.
    Dissection of floral induction pathways using global expression analysis.
    Development, 2003. 130(24): p. 6001-12
    [PMID:14573523]
  5. Yamada K, et al.
    Empirical analysis of transcriptional activity in the Arabidopsis genome.
    Science, 2003. 302(5646): p. 842-6
    [PMID:14593172]
  6. Vazquez F,Gasciolli V,Cr
    The nuclear dsRNA binding protein HYL1 is required for microRNA accumulation and plant development, but not posttranscriptional transgene silencing.
    Curr. Biol., 2004. 14(4): p. 346-51
    [PMID:14972688]
  7. Vaucheret H,Vazquez F,Cr
    The action of ARGONAUTE1 in the miRNA pathway and its regulation by the miRNA pathway are crucial for plant development.
    Genes Dev., 2004. 18(10): p. 1187-97
    [PMID:15131082]
  8. Souret FF,Kastenmayer JP,Green PJ
    AtXRN4 degrades mRNA in Arabidopsis and its substrates include selected miRNA targets.
    Mol. Cell, 2004. 15(2): p. 173-83
    [PMID:15260969]
  9. Cao D,Cheng H,Wu W,Soo HM,Peng J
    Gibberellin mobilizes distinct DELLA-dependent transcriptomes to regulate seed germination and floral development in Arabidopsis.
    Plant Physiol., 2006. 142(2): p. 509-25
    [PMID:16920880]
  10. Wang JW,Schwab R,Czech B,Mica E,Weigel D
    Dual effects of miR156-targeted SPL genes and CYP78A5/KLUH on plastochron length and organ size in Arabidopsis thaliana.
    Plant Cell, 2008. 20(5): p. 1231-43
    [PMID:18492871]
  11. Wu G, et al.
    The sequential action of miR156 and miR172 regulates developmental timing in Arabidopsis.
    Cell, 2009. 138(4): p. 750-9
    [PMID:19703400]
  12. Shikata M,Koyama T,Mitsuda N,Ohme-Takagi M
    Arabidopsis SBP-box genes SPL10, SPL11 and SPL2 control morphological change in association with shoot maturation in the reproductive phase.
    Plant Cell Physiol., 2009. 50(12): p. 2133-45
    [PMID:19880401]
  13. Nodine MD,Bartel DP
    MicroRNAs prevent precocious gene expression and enable pattern formation during plant embryogenesis.
    Genes Dev., 2010. 24(23): p. 2678-92
    [PMID:21123653]
  14. Jin J, et al.
    An Arabidopsis Transcriptional Regulatory Map Reveals Distinct Functional and Evolutionary Features of Novel Transcription Factors.
    Mol. Biol. Evol., 2015. 32(7): p. 1767-73
    [PMID:25750178]