PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID AT1G26945.1
Common NameBHLH163, KDR, PRE6, T2P11
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis
Family bHLH
Protein Properties Length: 94aa    MW: 10717.9 Da    PI: 9.2503
Description bHLH family protein
Gene Model
Gene Model ID Type Source Coding Sequence
AT1G26945.1genomeTAIRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1HLH25.81.9e-0820601454
                 HHHHHHHHHHHCTSCCC...TTS-STCHHHHHHHHHHHHHH CS
          HLH 14 driNsafeeLrellPkaskapskKlsKaeiLekAveYIksL 54
                 d+i +  ++L+ l+P++ + +s K+s + +L+++++YI++L
  AT1G26945.1 20 DQISDLVSKLQHLIPELRRRRSDKVSASKVLQETCNYIRNL 60
                 6899999*********889********************99 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5088810.442660IPR011598Myc-type, basic helix-loop-helix (bHLH) domain
Gene3DG3DSA:4.10.280.107.7E-92074IPR011598Myc-type, basic helix-loop-helix (bHLH) domain
SuperFamilySSF474593.01E-92079IPR011598Myc-type, basic helix-loop-helix (bHLH) domain
PfamPF000106.8E-62060IPR011598Myc-type, basic helix-loop-helix (bHLH) domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009416Biological Processresponse to light stimulus
GO:0040008Biological Processregulation of growth
GO:0005634Cellular Componentnucleus
GO:0005737Cellular Componentcytoplasm
GO:0046983Molecular Functionprotein dimerization activity
Plant Ontology ? help Back to Top
PO Term PO Category PO Description
PO:0000293anatomyguard cell
Sequence ? help Back to Top
Protein Sequence    Length: 94 aa     Download sequence    Send to blast
MSSRRSSRSR QSGSSRISDD QISDLVSKLQ HLIPELRRRR SDKVSASKVL QETCNYIRNL  60
HREVDDLSDR LSELLASTDD NSAEAAIIRS LLNY
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
At.447429e-71bud| floral meristem| seed
Expression -- Microarray ? help Back to Top
Source ID
Expression AtlasAT1G26945
AtGenExpressAT1G26945
Functional Description ? help Back to Top
Source Description
TAIREncodes a basic helix-loop-helix (bHLH) protein involved in blue/far-red light signaling. Physically interacts with HFR1 and negatively regulates its activity.
UniProtAtypical and probable non DNA-binding bHLH transcription factor that regulates light-mediated responses in day light conditions by binding and inhibiting the activity of the bHLH transcription factor HFR1, a critical regulator of light signaling and shade avoidance. Forms non-functional heterodimers with HFR1, causing liberation and activation of PIF4 from the transcriptionally inactive HFR1-PIF4 complex. {ECO:0000269|PubMed:16786307, ECO:0000269|PubMed:23224238}.
Function -- GeneRIF ? help Back to Top
  1. KDR attenuates light mediated responses in day light condition through inhibition of the activity of basic Helix-Loop-Helix proteins involved in light signaling.
    [PMID: 16786307]
Cis-element ? help Back to Top
SourceLink
PlantRegMapAT1G26945.1
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: Circadian regulation with a peak of expression at midday. {ECO:0000269|PubMed:16786307}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Regulation -- ATRM (Manually Curated Target Genes) ? help Back to Top
Source Target Gene (A: Activate/R: Repress)
ATRM AT1G02340(R)
Interaction ? help Back to Top
Source Intact With
IntActSearch Q8GW32
Phenotype -- Mutation ? help Back to Top
Source ID
T-DNA ExpressAT1G26945
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankBT0046861e-158BT004686.1 Arabidopsis thaliana At1g26948 gene, complete cds.
GenBankAK1191101e-158AK119110.1 Arabidopsis thaliana mRNA for unknown protein, complete cds, clone: RAFL21-46-D20.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_849712.18e-59basic helix-loop-helix protein KIDARI
RefseqXP_002893369.18e-59hypothetical protein ARALYDRAFT_472704
RefseqXP_010498979.18e-59PREDICTED: transcription factor PRE6
SwissprotQ8GW321e-60PRE6_ARATH; Transcription factor PRE6
TrEMBLD7KPM59e-59D7KPM5_ARALL; Putative uncharacterized protein
STRINGfgenesh2_kg.1__2658__AT1G26945.12e-58(Arabidopsis lyrata)
STRINGAT1G26945.12e-58(Arabidopsis thaliana)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM25928225
Representative plantOGRP18771240
Publications ? help Back to Top
  1. Seki M, et al.
    Functional annotation of a full-length Arabidopsis cDNA collection.
    Science, 2002. 296(5565): p. 141-5
    [PMID:11910074]
  2. Yamada K, et al.
    Empirical analysis of transcriptional activity in the Arabidopsis genome.
    Science, 2003. 302(5646): p. 842-6
    [PMID:14593172]
  3. Lee S, et al.
    Overexpression of PRE1 and its homologous genes activates Gibberellin-dependent responses in Arabidopsis thaliana.
    Plant Cell Physiol., 2006. 47(5): p. 591-600
    [PMID:16527868]
  4. Hyun Y,Lee I
    KIDARI, encoding a non-DNA Binding bHLH protein, represses light signal transduction in Arabidopsis thaliana.
    Plant Mol. Biol., 2006. 61(1-2): p. 283-96
    [PMID:16786307]
  5. Cartagena JA, et al.
    The Arabidopsis SDG4 contributes to the regulation of pollen tube growth by methylation of histone H3 lysines 4 and 36 in mature pollen.
    Dev. Biol., 2008. 315(2): p. 355-68
    [PMID:18252252]
  6. Zhang LY, et al.
    Antagonistic HLH/bHLH transcription factors mediate brassinosteroid regulation of cell elongation and plant development in rice and Arabidopsis.
    Plant Cell, 2009. 21(12): p. 3767-80
    [PMID:20009022]
  7. Wang H, et al.
    Regulation of Arabidopsis brassinosteroid signaling by atypical basic helix-loop-helix proteins.
    Plant Cell, 2009. 21(12): p. 3781-91
    [PMID:20023194]
  8. Carretero-Paulet L, et al.
    Genome-wide classification and evolutionary analysis of the bHLH family of transcription factors in Arabidopsis, poplar, rice, moss, and algae.
    Plant Physiol., 2010. 153(3): p. 1398-412
    [PMID:20472752]
  9. Castelain M,Le Hir R,Bellini C
    The non-DNA-binding bHLH transcription factor PRE3/bHLH135/ATBS1/TMO7 is involved in the regulation of light signaling pathway in Arabidopsis.
    Physiol Plant, 2012. 145(3): p. 450-60
    [PMID:22339648]
  10. Meinke DW
    A survey of dominant mutations in Arabidopsis thaliana.
    Trends Plant Sci., 2013. 18(2): p. 84-91
    [PMID:22995285]
  11. Hong SY, et al.
    A competitive peptide inhibitor KIDARI negatively regulates HFR1 by forming nonfunctional heterodimers in Arabidopsis photomorphogenesis.
    Mol. Cells, 2013. 35(1): p. 25-31
    [PMID:23224238]
  12. Jin J, et al.
    An Arabidopsis Transcriptional Regulatory Map Reveals Distinct Functional and Evolutionary Features of Novel Transcription Factors.
    Mol. Biol. Evol., 2015. 32(7): p. 1767-73
    [PMID:25750178]