PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID AT1G26870.1
Common NameANAC009, FEZ, NAC009, T2P11.6
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis
Family NAC
Protein Properties Length: 425aa    MW: 48507.1 Da    PI: 6.5089
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
AT1G26870.1genomeTAIRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM169.88.9e-53231501128
          NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdkevlsk.kg 97 
                  l pGfrFhPtdeelv++yLk+kv++++l++ e i+++diyk++PwdLpk + ++ekewyf+++rd+ky++++r+nr+t +g+Wkatg+d++++s+ ++
  AT1G26870.1  23 LLPGFRFHPTDEELVSFYLKRKVQHNPLSI-ELIRQLDIYKYDPWDLPKFAMTGEKEWYFYCPRDRKYRNSSRPNRVTGAGFWKATGTDRPIYSSeGN 119
                  579***************************.89***************7777889***************************************9566 PP

          NAM  98 elvglkktLvfykgrapkgektdWvmheyrl 128
                  + +glkk+Lvfykgra kg+ktdW+mhe+rl
  AT1G26870.1 120 KCIGLKKSLVFYKGRAAKGVKTDWMMHEFRL 150
                  67***************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019411.96E-5919182IPR003441NAC domain
PROSITE profilePS5100557.53223182IPR003441NAC domain
PfamPF023651.3E-2525150IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009733Biological Processresponse to auxin
GO:0045770Biological Processpositive regulation of asymmetric cell division
GO:0048103Biological Processsomatic stem cell division
GO:0048829Biological Processroot cap development
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
Plant Ontology ? help Back to Top
PO Term PO Category PO Description
PO:0009005anatomyroot
PO:0009025anatomyvascular leaf
PO:0020131anatomylateral root cap
PO:0020133anatomycolumella root cap initial cell
PO:0001054developmental stagevascular leaf senescent stage
Sequence ? help Back to Top
Protein Sequence    Length: 425 aa     Download sequence    Send to blast
MAADPSEMGD RNNDGDQKME DVLLPGFRFH PTDEELVSFY LKRKVQHNPL SIELIRQLDI  60
YKYDPWDLPK FAMTGEKEWY FYCPRDRKYR NSSRPNRVTG AGFWKATGTD RPIYSSEGNK  120
CIGLKKSLVF YKGRAAKGVK TDWMMHEFRL PSLSEPSPPS KRFFDSPVSP NDSWAICRIF  180
KKTNTTTLRA LSHSFVSSLP PETSTDTMSN QKQSNTYHFS SDKILKPSSH FQFHHENMNT  240
PKTSNSTTPS VPTISPFSYL DFTSYDKPTN VFNPVSCLDQ QYLTNLFLAT QETQPQFPRL  300
PSSNEIPSFL LNTSSDSTFL GEFTSHIDLS AVLAQEQCPP LVSLPQEYQE TGFEGNGIMK  360
NMRGSNEDHL GDHCDTLRFD DFTSTINENH RHHQDLKQNM TLLESYYSSL SSINSDLPAC  420
FSSTT
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4dul_B5e-5661862169NAC domain-containing protein 19
4dul_A5e-5661862169NAC domain-containing protein 19
1ut7_B5e-5661862169NO APICAL MERISTEM PROTEIN
1ut7_A5e-5661862169NO APICAL MERISTEM PROTEIN
1ut4_B5e-5661862169NO APICAL MERISTEM PROTEIN
1ut4_A5e-5661862169NO APICAL MERISTEM PROTEIN
Search in ModeBase
Expression -- Microarray ? help Back to Top
Source ID E-value
GEO183960900.0
Genevisible263683_at0.0
Expression AtlasAT1G26870-
AtGenExpressAT1G26870-
ATTED-IIAT1G26870-
Expression -- Description ? help Back to Top
Source Description
UniprotDEVELOPMENTAL STAGE: First expressed at globular stage onward in the COL progenitors after the first division of the hypophyseal cell. Later observed in these cells and their descendants, mostly in direct daughter cells. Also detected in the Epi/LRC stem cells and daughters, and is retained in maturing LRC layers. Present in elongated stem cells that are about to divide. {ECO:0000269|PubMed:19081078}.
UniprotTISSUE SPECIFICITY: Expressed in root cap stem cells and their immediate daughters. {ECO:0000269|PubMed:19081078}.
Functional Description ? help Back to Top
Source Description
UniProtPromotes periclinal root capforming cell divisions. Activates expression of its negative regulator SMB in a feedback loop for controlled switches in cell division plane. {ECO:0000269|PubMed:19081078}.
Function -- GeneRIF ? help Back to Top
  1. FEZ and SOMBRERO (SMB), two plant-specific NAC-domain transcription factors, control the orientation of cell division plane in Arabidopsis root stem cells.
    [PMID: 19081078]
Cis-element ? help Back to Top
SourceLink
PlantRegMapAT1G26870.1
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: Repressed by SMB in oriented-divised root cap stem cells. {ECO:0000269|PubMed:19081078}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Regulation -- ATRM (Manually Curated Upstream Regulators) ? help Back to Top
Source Upstream Regulator (A: Activate/R: Repress)
ATRM AT1G79580 (R)
Regulation -- ATRM (Manually Curated Target Genes) ? help Back to Top
Source Target Gene (A: Activate/R: Repress)
ATRM AT1G79580(A)
Phenotype -- Disruption Phenotype ? help Back to Top
Source Description
UniProtDISRUPTION PHENOTYPE: Fewer root cap layers; reduced number of columella (COL) and lateral root cap (LRC) cell layers from late embryogenesis due to impaired periclinal divisions in epidermal (Epi)/LRC and COL stem cells. {ECO:0000269|PubMed:19081078}.
Phenotype -- Mutation ? help Back to Top
Source ID
T-DNA ExpressAT1G26870
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC0055080.0AC005508.1 Arabidopsis thaliana chromosome I BAC T2P11 genomic sequence, complete sequence.
GenBankCP0026840.0CP002684.1 Arabidopsis thaliana chromosome 1 sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_174009.10.0protein FEZ
SwissprotQ9ZVH00.0FEZ_ARATH; Protein FEZ
TrEMBLD7KPN80.0D7KPN8_ARALL; Putative uncharacterized protein
STRINGAT1G26870.10.0(Arabidopsis thaliana)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP1715800
MalvidsOGEM30628200
Publications ? help Back to Top
  1. Riechmann JL, et al.
    Arabidopsis transcription factors: genome-wide comparative analysis among eukaryotes.
    Science, 2000. 290(5499): p. 2105-10
    [PMID:11118137]
  2. Ooka H, et al.
    Comprehensive analysis of NAC family genes in Oryza sativa and Arabidopsis thaliana.
    DNA Res., 2003. 10(6): p. 239-47
    [PMID:15029955]
  3. Ballvora A, et al.
    Comparative sequence analysis of Solanum and Arabidopsis in a hot spot for pathogen resistance on potato chromosome V reveals a patchwork of conserved and rapidly evolving genome segments.
    BMC Genomics, 2007. 8: p. 112
    [PMID:17474978]
  4. Willemsen V, et al.
    The NAC domain transcription factors FEZ and SOMBRERO control the orientation of cell division plane in Arabidopsis root stem cells.
    Dev. Cell, 2008. 15(6): p. 913-22
    [PMID:19081078]
  5. Jin J, et al.
    An Arabidopsis Transcriptional Regulatory Map Reveals Distinct Functional and Evolutionary Features of Novel Transcription Factors.
    Mol. Biol. Evol., 2015. 32(7): p. 1767-73
    [PMID:25750178]