PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID AT1G26790.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis
Family Dof
Protein Properties Length: 396aa    MW: 44742.8 Da    PI: 7.2811
Description Dof family protein
Gene Model
Gene Model ID Type Source Coding Sequence
AT1G26790.1genomeTAIRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-Dof117.55.1e-37131190261
       zf-Dof   2 kekalkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknkks 61 
                  ++k+l+cprC+s++tkfCyynny+++qPr+fC++C+ryWt+GG++r vPvG+grrknk +
  AT1G26790.1 131 PDKILPCPRCNSADTKFCYYNNYNVNQPRHFCRKCQRYWTAGGSMRIVPVGSGRRKNKGW 190
                  7899*****************************************************976 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
ProDomPD0074786.0E-32128188IPR003851Zinc finger, Dof-type
PfamPF027011.3E-30133188IPR003851Zinc finger, Dof-type
PROSITE profilePS5088427.941135189IPR003851Zinc finger, Dof-type
PROSITE patternPS013610137173IPR003851Zinc finger, Dof-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0046872Molecular Functionmetal ion binding
Plant Ontology ? help Back to Top
PO Term PO Category PO Description
PO:0009047anatomystem
Sequence ? help Back to Top
Protein Sequence    Length: 396 aa     Download sequence    Send to blast
MWLSHLFMSL SKLTCNFSIF SVFMACGSIG MSQVRDTPVK LFGWTITPVS HDPYSSSSHV  60
LPDSSSSSSS SSLSLRPHMM NNQSVTDNTS LKLSSNLNNE SKETSENSDD QHSEITTITS  120
EEEKTTELKK PDKILPCPRC NSADTKFCYY NNYNVNQPRH FCRKCQRYWT AGGSMRIVPV  180
GSGRRKNKGW VSSDQYLHIT SEDTDNYNSS STKILSFESS DSLVTERPKH QSNEVKINAE  240
PVSQEPNNFQ GLLPPQASPV SPPWPYQYPP NPSFYHMPVY WGCAIPVWST LDTSTCLGKR  300
TRDETSHETV KESKNAFERT SLLLESQSIK NETSMATNNH VWYPVPMTRE KTQEFSFFSN  360
GAETKSSNNR FVPETYLNLQ ANPAAMARSM NFRESI
Expression -- Microarray ? help Back to Top
Source ID E-value
GEO183960550.0
Genevisible261263_at0.0
Expression AtlasAT1G26790-
AtGenExpressAT1G26790-
ATTED-IIAT1G26790-
Functional Description ? help Back to Top
Source Description
UniProtTranscription factor that binds specifically to a 5'-AA[AG]G-3' consensus core sequence. {ECO:0000250}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapAT1G26790.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Phenotype -- Mutation ? help Back to Top
Source ID
T-DNA ExpressAT1G26790
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC0065350.0AC006535.7 Genomic sequence for Arabidopsis thaliana BAC T24P13 from chromosome I, complete sequence.
GenBankCP0026840.0CP002684.1 Arabidopsis thaliana chromosome 1 sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_174001.20.0Dof-type zinc finger DNA-binding family protein
SwissprotQ9LQX40.0DOF13_ARATH; Dof zinc finger protein DOF1.3
TrEMBLA0A178W5Q60.0A0A178W5Q6_ARATH; Uncharacterized protein
STRINGAT1G26790.10.0(Arabidopsis thaliana)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM140821624
Representative plantOGRP3817445
Publications ? help Back to Top
  1. Riechmann JL, et al.
    Arabidopsis transcription factors: genome-wide comparative analysis among eukaryotes.
    Science, 2000. 290(5499): p. 2105-10
    [PMID:11118137]
  2. Yanagisawa S
    The Dof family of plant transcription factors.
    Trends Plant Sci., 2002. 7(12): p. 555-60
    [PMID:12475498]
  3. Lijavetzky D,Carbonero P,Vicente-Carbajosa J
    Genome-wide comparative phylogenetic analysis of the rice and Arabidopsis Dof gene families.
    BMC Evol. Biol., 2003. 3: p. 17
    [PMID:12877745]
  4. Wagner R,Pfannschmidt T
    Eukaryotic transcription factors in plastids--Bioinformatic assessment and implications for the evolution of gene expression machineries in plants.
    Gene, 2006. 381: p. 62-70
    [PMID:16934950]
  5. Yang X,Tuskan GA,Cheng MZ
    Divergence of the Dof gene families in poplar, Arabidopsis, and rice suggests multiple modes of gene evolution after duplication.
    Plant Physiol., 2006. 142(3): p. 820-30
    [PMID:16980566]
  6. Chawade A,Br
    Putative cold acclimation pathways in Arabidopsis thaliana identified by a combined analysis of mRNA co-expression patterns, promoter motifs and transcription factors.
    BMC Genomics, 2007. 8: p. 304
    [PMID:17764576]
  7. Hanada K, et al.
    Functional compensation of primary and secondary metabolites by duplicate genes in Arabidopsis thaliana.
    Mol. Biol. Evol., 2011. 28(1): p. 377-82
    [PMID:20736450]