PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID AT1G26780.2
Common NameAtMYB117, LOF1, MYB117
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis
Family MYB
Protein Properties Length: 359aa    MW: 41534.3 Da    PI: 7.0645
Description myb domain protein 117
Gene Model
Gene Model ID Type Source Coding Sequence
AT1G26780.2genomeTAIRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding50.74e-1698143147
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                      rg W + Ed +l+++v  +G+ +W++Ia++++ gR++k+c++rw++ 
      AT1G26780.2  98 RGHWRPAEDVKLKELVSIYGPQNWNLIAEKLQ-GRSGKSCRLRWFNQ 143
                      899*****************************.***********996 PP

2Myb_DNA-binding59.48.2e-19150194147
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                      r ++T+eE+e+l +a++++G++ W+ Iar ++ gRt++++k++w+ +
      AT1G26780.2 150 RRAFTEEEEERLMQAHRLYGNK-WAMIARLFP-GRTDNSVKNHWHVV 194
                      678*******************.*********.***********976 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129416.5893144IPR017930Myb domain
SMARTSM007176.5E-1497146IPR001005SANT/Myb domain
SuperFamilySSF466891.91E-2898191IPR009057Homeodomain-like
PfamPF002491.2E-1598143IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.606.6E-2699151IPR009057Homeodomain-like
CDDcd001676.06E-12101142No hitNo description
PROSITE profilePS5129428.155145199IPR017930Myb domain
SMARTSM007172.4E-15149197IPR001005SANT/Myb domain
PfamPF002491.3E-15150193IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.602.0E-21152198IPR009057Homeodomain-like
CDDcd001671.66E-11152195No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006357Biological Processregulation of transcription from RNA polymerase II promoter
GO:0010199Biological Processorgan boundary specification between lateral organs and the meristem
GO:0030154Biological Processcell differentiation
GO:0005634Cellular Componentnucleus
GO:0000981Molecular FunctionRNA polymerase II transcription factor activity, sequence-specific DNA binding
GO:0001135Molecular Functiontranscription factor activity, RNA polymerase II transcription factor recruiting
GO:0043565Molecular Functionsequence-specific DNA binding
GO:0044212Molecular Functiontranscription regulatory region DNA binding
Plant Ontology ? help Back to Top
PO Term PO Category PO Description
PO:0000037anatomyshoot apex
PO:0009009anatomyplant embryo
PO:0009010anatomyseed
PO:0009031anatomysepal
PO:0009046anatomyflower
PO:0025022anatomycollective leaf structure
PO:0001078developmental stageplant embryo cotyledonary stage
PO:0001081developmental stagemature plant embryo stage
PO:0004507developmental stageplant embryo bilateral stage
PO:0007611developmental stagepetal differentiation and expansion stage
Sequence ? help Back to Top
Protein Sequence    Length: 359 aa     Download sequence    Send to blast
MFITEKQVWM DEIVARRASS SWDFPFNDIN IHQHHHRHCN TSHEFEILKS PLGDVAVHEE  60
ESNNNNPNFS NSESGKKETT DSGQSWSSSS SKPSVLGRGH WRPAEDVKLK ELVSIYGPQN  120
WNLIAEKLQG RSGKSCRLRW FNQLDPRINR RAFTEEEEER LMQAHRLYGN KWAMIARLFP  180
GRTDNSVKNH WHVVMARKYR EHSSAYRRRK LMSNNPLKPH LTNNHHPNPN PNYHSFISTN  240
HYFAQPFPEF NLTHHLVNNA PITSDHNQLV LPFHCFQGYE NNEPPMVVSM FGNQMMVGDN  300
VGATSDALCN IPHIDPSNQE KPEPNDAMHW IGMDAVDEEV FEKAKQQPHF FDFLGLGTA
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A2e-31961985107B-MYB
Search in ModeBase
Expression -- Microarray ? help Back to Top
Source ID E-value
Genevisible261274_at0.0
Expression AtlasAT1G26780-
AtGenExpressAT1G26780-
ATTED-IIAT1G26780-
Expression -- Description ? help Back to Top
Source Description
UniprotTISSUE SPECIFICITY: Expressed in organ boundaries. {ECO:0000269|PubMed:19542355}.
Functional Description ? help Back to Top
Source Description
TAIREncodes LOF1 (LATERAL ORGAN FUSION1), a MYB-domain transcription factor expressed in organ boundaries. Functions in boundary specification, meristem initiation and maintenance, and organ patterning. Also see LOF2 (At1g69560).
UniProtProbable transcription factor that involved in boundary specification, meristem initiation and maintenance, and organ patterning (PubMed:19542355, PubMed:21533201). Functions in both lateral organ separation and axillary meristem formation, in part through genetic interaction with the NAC domain genes CUC2 and CUC3 and the homeobox gene STM (PubMed:19542355). May be recruited by a variety of developmental programs for the development of floral organs and the initiation of ovule outgrowth (PubMed:21533201). {ECO:0000269|PubMed:19542355, ECO:0000269|PubMed:21533201}.
Function -- GeneRIF ? help Back to Top
  1. results suggest that AtMYB117/LOF1 is recruited by a variety of developmental programs for the establishment of boundary regions, including the development of floral organs and the initiation of ovule outgrowth
    [PMID: 21533201]
Cis-element ? help Back to Top
SourceLink
PlantRegMapAT1G26780.2
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Phenotype -- Mutation ? help Back to Top
Source ID
T-DNA ExpressAT1G26780
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAF3348160.0AF334816.1 Arabidopsis thaliana putative transcription factor (MYB117) mRNA, complete cds.
GenBankAY5195590.0AY519559.1 Arabidopsis thaliana MYB transcription factor (At1g26780) mRNA, complete cds.
GenBankDQ4462910.0DQ446291.1 Arabidopsis thaliana clone pENTR221-At1g26780 myb family transcription factor (At1g26780) mRNA, complete cds.
GenBankDQ6528620.0DQ652862.1 Arabidopsis thaliana clone 0000017266_0000012084 unknown mRNA.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_001154369.10.0myb domain protein 117
SwissprotQ9LQX50.0MY117_ARATH; Transcription factor MYB117
TrEMBLA0A178WCI30.0A0A178WCI3_ARATH; MYB117
STRINGAT1G26780.20.0(Arabidopsis thaliana)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM12102896
Representative plantOGRP5171784
Publications ? help Back to Top
  1. Riechmann JL, et al.
    Arabidopsis transcription factors: genome-wide comparative analysis among eukaryotes.
    Science, 2000. 290(5499): p. 2105-10
    [PMID:11118137]
  2. Stracke R,Werber M,Weisshaar B
    The R2R3-MYB gene family in Arabidopsis thaliana.
    Curr. Opin. Plant Biol., 2001. 4(5): p. 447-56
    [PMID:11597504]
  3. Duarte JM, et al.
    Expression pattern shifts following duplication indicative of subfunctionalization and neofunctionalization in regulatory genes of Arabidopsis.
    Mol. Biol. Evol., 2006. 23(2): p. 469-78
    [PMID:16280546]
  4. Yanhui C, et al.
    The MYB transcription factor superfamily of Arabidopsis: expression analysis and phylogenetic comparison with the rice MYB family.
    Plant Mol. Biol., 2006. 60(1): p. 107-24
    [PMID:16463103]
  5. Lee DK,Geisler M,Springer PS
    LATERAL ORGAN FUSION1 and LATERAL ORGAN FUSION2 function in lateral organ separation and axillary meristem formation in Arabidopsis.
    Development, 2009. 136(14): p. 2423-32
    [PMID:19542355]
  6. Gomez MD,Urbez C,Perez-Amador MA,Carbonell J
    Characterization of constricted fruit (ctf) mutant uncovers a role for AtMYB117/LOF1 in ovule and fruit development in Arabidopsis thaliana.
    PLoS ONE, 2011. 6(4): p. e18760
    [PMID:21533201]
  7. Meinke DW
    A survey of dominant mutations in Arabidopsis thaliana.
    Trends Plant Sci., 2013. 18(2): p. 84-91
    [PMID:22995285]
  8. Naz AA, et al.
    Trifoliate encodes an MYB transcription factor that modulates leaf and shoot architecture in tomato.
    Proc. Natl. Acad. Sci. U.S.A., 2013. 110(6): p. 2401-6
    [PMID:23341595]
  9. Colling J, et al.
    Hypersensitivity of Arabidopsis TAXIMIN1 overexpression lines to light stress is correlated with decreased sinapoyl malate abundance and countered by the antibiotic cefotaxime.
    Plant Signal Behav, 2016. 11(4): p. e1143998
    [PMID:26967827]