PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID AT1G26680.1
Common NameREM17, T24P13.6
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis
Family B3
Protein Properties Length: 920aa    MW: 104833 Da    PI: 9.8945
Description B3 family protein
Gene Model
Gene Model ID Type Source Coding Sequence
AT1G26680.1genomeTAIRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1B351.61.7e-16231011296
                  HTT-EE--HHH.HTT.---..--SEEEEEE.TTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE-SSSEE..EEEE CS
           B3  12 ksgrlvlpkkfaeeh.ggkkeesktltled.esgrsWevkliyrkksgryvltkGWkeFvkangLkegDfvvFkldgrsefelvvkv 96 
                  ++  l +p  f+++h +g ++++kt+tl++  s ++W vk+  ++ +    lt+GW++F+ a++L++gD+vvF+l+g++ f  +v++
  AT1G26680.1  23 SRTHLNIPVAFFSKHvEGRNNQNKTVTLRSdASDKTWLVKM--DGLK----LTDGWEDFAFAHDLRTGDIVVFRLEGEMVF--HVTA 101
                  344488**********77888999*****97889*******..6666....************************998888..6665 PP

2B369.45e-22159249799
                  .-HHHHTT-EE--HHH.HTT---..--SEEEEEETTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE-SSSEE..EEEEE-S CS
           B3   7 psdvlksgrlvlpkkfaeehggkkeesktltledesgrsWevkliyrkksgryvltkGWkeFvkangLkegDfvvFkldgrsefelvvkvfrk 99 
                  ++  l+++rl++p +fa+ +g++k +sk++ l++e+grsW++ l+++k++ +++ ++GW++F+++ng+++g   +Fkl++ +++ +v++++r+
  AT1G26680.1 159 SAWCLSNDRLYIPLSFARLNGLNKINSKKIYLQNEEGRSWKLVLRHDKSGMQTFVQSGWRRFCSENGIRQGQY-TFKLVR-KSAPPVIRLCRA 249
                  5667899*****************************************************************6.***998.8999******97 PP

3B366.34.5e-21271360598
                  -..-HHHHTT-EE--HHH.HTT---..--SEEEEEETTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE-SSSEE..EEEEE- CS
           B3   5 ltpsdvlksgrlvlpkkfaeehggkkeesktltledesgrsWevkliyrkksgryvltkGWkeFvkangLkegDfvvFkldgrsefelvvkvfr 98 
                   +++++l++++l+lp++f++++ ++k++s +++l++e+g +W + l  ++ ++ ++l kGW +F++ n++k+gD++ Fkl+g + +++v++++ 
  AT1G26680.1 271 SVTPSSLRNDLLYLPRSFVNSNRLDKRCS-EIVLKNEQGVKWPLVL--KRFKSVTYLPKGWTSFCQVNRIKAGDSFKFKLVG-TWKKPVLSLCP 360
                  578999*******************9998.****************..999999**************************99.77778998886 PP

4B357.13.4e-18441530698
                  ..-HHHHTT-EE--HHH.HTT---..--SEEEEEETTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE-SSSEE..EEEEE- CS
           B3   6 tpsdvlksgrlvlpkkfaeehggkkeesktltledesgrsWevkliyrkksgryvltkGWkeFvkangLkegDfvvFkldgrsefelvvkvfr 98 
                  +++++l +++l+lp++f++++ ++k++s +++l++e+g++ ++ l++ kk+  ++l+kGW +F++ n++k+gD++ Fkl+g +  ++v++++ 
  AT1G26680.1 441 VNPSSLYKDQLYLPRNFVSSNFLDKRCS-EIVLKNERGEKRTLVLKHFKKD-LTFLKKGWTSFCQVNRIKAGDSFKFKLVG-TWNKPVLSLCP 530
                  6788999999***********9999998.****************665555.478************************99.77778988886 PP

5B367.61.8e-21620707593
                  -..-HHHHTT-EE--HHH.HTT---..--SEEEEEETTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE-SSSEE..E CS
           B3   5 ltpsdvlksgrlvlpkkfaeehggkkeesktltledesgrsWevkliyrkksgryvltkGWkeFvkangLkegDfvvFkldgrsefelv 93 
                   +++++l+ +rl+lp +f++++g++k ++k+++l +e+g sW+++l+y++ +++++ + GW++F++ang+ +g  ++Fkl++ + + +v
  AT1G26680.1 620 NVTASSLNYDRLYLPLSFVSSNGLDKMNGKEIVLLNEEGLSWKFNLKYNQAGKHTYVRPGWSRFCDANGMSQGQQFTFKLVQ-KHGPPV 707
                  67899999***********************************************************************998.555555 PP

6B370.42.3e-22732822698
                  ..-HHHHTT-EE--HHH.HTT---..--SEEEEEETTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE-SSSEE..EEEEE- CS
           B3   6 tpsdvlksgrlvlpkkfaeehggkkeesktltledesgrsWevkliyrkksgryvltkGWkeFvkangLkegDfvvFkldgrsefelvvkvfr 98 
                  +++++ k++ l+l k+f++++g++k + k+++l++++gr+W++ l++ k+ + +++++GW +F++ ngLk+gD++ Fkl+g +++++v++++ 
  AT1G26680.1 732 VTASSIKKDKLYLWKSFVSSNGLDKGC-KKIILKNKWGREWKLVLKHYKSNCFTIIKRGWTSFCQGNGLKAGDSFKFKLVG-TGEKPVLSLCP 822
                  6788999999**************977.7**************************************************99.77779999886 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:2.40.330.107.9E-2310116IPR015300DNA-binding pseudobarrel domain
SuperFamilySSF1019367.06E-1910111IPR015300DNA-binding pseudobarrel domain
PROSITE profilePS5086313.21112105IPR003340B3 DNA binding domain
CDDcd100171.16E-1313100No hitNo description
SMARTSM010193.8E-2315105IPR003340B3 DNA binding domain
PfamPF023621.1E-102397IPR003340B3 DNA binding domain
Gene3DG3DSA:2.40.330.106.4E-16147247IPR015300DNA-binding pseudobarrel domain
SuperFamilySSF1019364.32E-16151251IPR015300DNA-binding pseudobarrel domain
PROSITE profilePS5086313.662153250IPR003340B3 DNA binding domain
SMARTSM010198.4E-28154250IPR003340B3 DNA binding domain
PfamPF023621.0E-20158249IPR003340B3 DNA binding domain
CDDcd100179.02E-15162248No hitNo description
Gene3DG3DSA:2.40.330.102.2E-20260361IPR015300DNA-binding pseudobarrel domain
SuperFamilySSF1019362.16E-20263362IPR015300DNA-binding pseudobarrel domain
CDDcd100173.00E-13267350No hitNo description
PROSITE profilePS5086314.367267361IPR003340B3 DNA binding domain
SMARTSM010192.6E-26268362IPR003340B3 DNA binding domain
PfamPF023628.0E-20271360IPR003340B3 DNA binding domain
Gene3DG3DSA:2.40.330.101.8E-19429531IPR015300DNA-binding pseudobarrel domain
SuperFamilySSF1019361.92E-18430530IPR015300DNA-binding pseudobarrel domain
CDDcd100171.29E-13436530No hitNo description
PROSITE profilePS5086312.407436531IPR003340B3 DNA binding domain
SMARTSM010192.5E-27437532IPR003340B3 DNA binding domain
PfamPF023624.0E-17441530IPR003340B3 DNA binding domain
Gene3DG3DSA:2.40.330.102.9E-20609707IPR015300DNA-binding pseudobarrel domain
SuperFamilySSF1019362.35E-19610710IPR015300DNA-binding pseudobarrel domain
PROSITE profilePS5086314.452616714IPR003340B3 DNA binding domain
CDDcd100173.07E-14616704No hitNo description
SMARTSM010191.7E-27617714IPR003340B3 DNA binding domain
PfamPF023622.9E-20619708IPR003340B3 DNA binding domain
Gene3DG3DSA:2.40.330.104.2E-21719822IPR015300DNA-binding pseudobarrel domain
SuperFamilySSF1019366.87E-22723824IPR015300DNA-binding pseudobarrel domain
CDDcd100173.75E-20727822No hitNo description
PROSITE profilePS5086314.381727823IPR003340B3 DNA binding domain
SMARTSM010199.6E-31728824IPR003340B3 DNA binding domain
PfamPF023621.1E-21731823IPR003340B3 DNA binding domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0009507Cellular Componentchloroplast
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
Plant Ontology ? help Back to Top
PO Term PO Category PO Description
PO:0009009anatomyplant embryo
PO:0020003anatomyplant ovule
PO:0004507developmental stageplant embryo bilateral stage
Sequence ? help Back to Top
Protein Sequence    Length: 920 aa     Download sequence    Send to blast
MADQSLLHSP INPHFFQPIL TESRTHLNIP VAFFSKHVEG RNNQNKTVTL RSDASDKTWL  60
VKMDGLKLTD GWEDFAFAHD LRTGDIVVFR LEGEMVFHVT ALGPSCCEIQ YHTSSHNIND  120
DDRNDQINIA SRNSSRVKKN PRKKVESSLD HSRFVAKVSA WCLSNDRLYI PLSFARLNGL  180
NKINSKKIYL QNEEGRSWKL VLRHDKSGMQ TFVQSGWRRF CSENGIRQGQ YTFKLVRKSA  240
PPVIRLCRAK AKPKQRSVAE YSSDHSCFEG SVTPSSLRND LLYLPRSFVN SNRLDKRCSE  300
IVLKNEQGVK WPLVLKRFKS VTYLPKGWTS FCQVNRIKAG DSFKFKLVGT WKKPVLSLCP  360
TQSNNHKTPL ECSEGNKSEE SEEDCLEVKK KKYWSRCRAS VENMDDDQTN IGNSSRKKRV  420
SKNPREKVES SSDHSSFVGS VNPSSLYKDQ LYLPRNFVSS NFLDKRCSEI VLKNERGEKR  480
TLVLKHFKKD LTFLKKGWTS FCQVNRIKAG DSFKFKLVGT WNKPVLSLCP TETNYHKTPL  540
ACSEGNKSEE SEEEGTEDKN TSQDCLEVKK RKYWSTCRAS AENIDDDQTN IGNSSKEKRV  600
KKNPVKKAES SSDHSSFVAN VTASSLNYDR LYLPLSFVSS NGLDKMNGKE IVLLNEEGLS  660
WKFNLKYNQA GKHTYVRPGW SRFCDANGMS QGQQFTFKLV QKHGPPVMYL SLSEHRPKSE  720
SSSHRSYFVG SVTASSIKKD KLYLWKSFVS SNGLDKGCKK IILKNKWGRE WKLVLKHYKS  780
NCFTIIKRGW TSFCQGNGLK AGDSFKFKLV GTGEKPVLSL CPAESSHEKI PLECPEGIDD  840
VNSLSSNPSS GDDSSRSEES EEENMEDKNI SQDCLETKKR KYCSSSSYSQ NRFVTLTLTR  900
SAFQTYKLVS FFNNYASRLS
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
At.412080.0seed
Expression -- Microarray ? help Back to Top
Source ID E-value
Genevisible261260_at0.0
Expression AtlasAT1G26680-
AtGenExpressAT1G26680-
ATTED-IIAT1G26680-
Cis-element ? help Back to Top
SourceLink
PlantRegMapAT1G26680.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Phenotype -- Mutation ? help Back to Top
Source ID
T-DNA ExpressAT1G26680
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankBT0029470.0BT002947.1 Arabidopsis thaliana clone RAFL15-02-G15 (R20317) unknown protein (At1g26680) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_173990.20.0transcriptional factor B3 family protein
SwissprotQ84WP30.0REM17_ARATH; B3 domain-containing protein REM17
TrEMBLA0A178WFQ40.0A0A178WFQ4_ARATH; Transcriptional factor B3 family protein
TrEMBLA0A384LI420.0A0A384LI42_ARATH; Uncharacterized protein
STRINGAT1G26680.10.0(Arabidopsis thaliana)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM57811648
Representative plantOGRP2682231
Publications ? help Back to Top
  1. Yamada K, et al.
    Empirical analysis of transcriptional activity in the Arabidopsis genome.
    Science, 2003. 302(5646): p. 842-6
    [PMID:14593172]
  2. Ekman DR,Wolfe NL,Dean JF
    Gene expression changes in Arabidopsis thaliana seedling roots exposed to the munition hexahydro-1,3,5-trinitro-1,3,5-triazine.
    Environ. Sci. Technol., 2005. 39(16): p. 6313-20
    [PMID:16173598]
  3. Zybailov B, et al.
    Sorting signals, N-terminal modifications and abundance of the chloroplast proteome.
    PLoS ONE, 2008. 3(4): p. e1994
    [PMID:18431481]
  4. Swaminathan K,Peterson K,Jack T
    The plant B3 superfamily.
    Trends Plant Sci., 2008. 13(12): p. 647-55
    [PMID:18986826]
  5. Skinner DJ,Gasser CS
    Expression-based discovery of candidate ovule development regulators through transcriptional profiling of ovule mutants.
    BMC Plant Biol., 2009. 9: p. 29
    [PMID:19291320]
  6. Mantegazza O, et al.
    Analysis of the arabidopsis REM gene family predicts functions during flower development.
    Ann. Bot., 2014. 114(7): p. 1507-15
    [PMID:25002525]