PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID AT1G25440.1
Common NameBBX15, COL16, F2J7.10
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis
Family CO-like
Protein Properties Length: 417aa    MW: 46931.6 Da    PI: 4.9915
Description B-box type zinc finger protein with CCT domain
Gene Model
Gene Model ID Type Source Coding Sequence
AT1G25440.1genomeTAIRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-B_box26.31.6e-081457340
     zf-B_box  3 erkCpeHeekelqlfCedCqqllCedClleeHkg......Htvv 40
                 +r C+ + + +++++C  ++ +lC++C +  H+       H++v
  AT1G25440.1 14 ARACDSCVKRRARWYCAADDAFLCQSCDSLVHSAnplarrHERV 57
                 578*****************************657888888876 PP

2CCT68.12.4e-23361404144
          CCT   1 ReaallRYkeKrktRkFeKkirYesRKavAesRpRvKGrFvkqa 44 
                  Rea+++RY+eKr+tR+F+KkirYe+RK +Ae+RpR+KGrFvk+a
  AT1G25440.1 361 REARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRMKGRFVKRA 404
                  9*****************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003368.0E-101259IPR000315B-box-type zinc finger
PROSITE profilePS5011910.8081259IPR000315B-box-type zinc finger
PfamPF006433.4E-71457IPR000315B-box-type zinc finger
CDDcd000215.79E-101559No hitNo description
PfamPF062036.9E-18361403IPR010402CCT domain
PROSITE profilePS5101716.083361403IPR010402CCT domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0016020Cellular Componentmembrane
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0005515Molecular Functionprotein binding
GO:0008270Molecular Functionzinc ion binding
Plant Ontology ? help Back to Top
PO Term PO Category PO Description
PO:0000293anatomyguard cell
PO:0009025anatomyvascular leaf
Sequence ? help Back to Top
Protein Sequence    Length: 417 aa     Download sequence    Send to blast
MMKSLANAVG AKTARACDSC VKRRARWYCA ADDAFLCQSC DSLVHSANPL ARRHERVRLK  60
TASPAVVKHS NHSSASPPHE VATWHHGFTR KARTPRGSGK KNNSSIFHDL VPDISIEDQT  120
DNYELEEQLI CQVPVLDPLV SEQFLNDVVE PKIEFPMIRS GLMIEEEEDN AESCLNGFFP  180
TDMELEEFAA DVETLLGRGL DTESYAMEEL GLSNSEMFKI EKDEIEEEVE EIKAMSMDIF  240
DDDRKDVDGT VPFELSFDYE SSHKTSEEEV MKNVESSGEC VVKVKEEEHK NVLMLRLNYD  300
SVISTWGGQG PPWSSGEPPE RDMDISGWPA FSMVENGGES THQKQYVGGC LPSSGFGDGG  360
REARVSRYRE KRRTRLFSKK IRYEVRKLNA EKRPRMKGRF VKRASLAAAA SPLGVNY
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1371387RRTRLFSKKIRYEVRKL
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
At.274940.0flower| inflorescence| silique
Expression -- Microarray ? help Back to Top
Source ID E-value
GEO1453361110.0
Genevisible260266_at1e-39
Expression AtlasAT1G25440-
AtGenExpressAT1G25440-
Cis-element ? help Back to Top
SourceLink
PlantRegMapAT1G25440.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Phenotype -- Mutation ? help Back to Top
Source ID
T-DNA ExpressAT1G25440
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK2264360.0AK226436.1 Arabidopsis thaliana mRNA for hypothetical protein, complete cds, clone: RAFL06-11-K13.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_173915.20.0zinc finger protein CONSTANS-LIKE 16
SwissprotQ8RWD00.0COL16_ARATH; Zinc finger protein CONSTANS-LIKE 16
TrEMBLQ5XF380.0Q5XF38_ARATH; At1g25440
STRINGAT1G25440.10.0(Arabidopsis thaliana)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP8021649
MalvidsOGEM24672767
Publications ? help Back to Top
  1. Riechmann JL, et al.
    Arabidopsis transcription factors: genome-wide comparative analysis among eukaryotes.
    Science, 2000. 290(5499): p. 2105-10
    [PMID:11118137]
  2. Robson F, et al.
    Functional importance of conserved domains in the flowering-time gene CONSTANS demonstrated by analysis of mutant alleles and transgenic plants.
    Plant J., 2001. 28(6): p. 619-31
    [PMID:11851908]
  3. Griffiths S,Dunford RP,Coupland G,Laurie DA
    The evolution of CONSTANS-like gene families in barley, rice, and Arabidopsis.
    Plant Physiol., 2003. 131(4): p. 1855-67
    [PMID:12692345]
  4. Yamada K, et al.
    Empirical analysis of transcriptional activity in the Arabidopsis genome.
    Science, 2003. 302(5646): p. 842-6
    [PMID:14593172]
  5. Jiao Y, et al.
    A genome-wide analysis of blue-light regulation of Arabidopsis transcription factor gene expression during seedling development.
    Plant Physiol., 2003. 133(4): p. 1480-93
    [PMID:14605227]
  6. Czechowski T,Bari RP,Stitt M,Scheible WR,Udvardi MK
    Real-time RT-PCR profiling of over 1400 Arabidopsis transcription factors: unprecedented sensitivity reveals novel root- and shoot-specific genes.
    Plant J., 2004. 38(2): p. 366-79
    [PMID:15078338]
  7. Scheible WR, et al.
    Genome-wide reprogramming of primary and secondary metabolism, protein synthesis, cellular growth processes, and the regulatory infrastructure of Arabidopsis in response to nitrogen.
    Plant Physiol., 2004. 136(1): p. 2483-99
    [PMID:15375205]
  8. Hilson P, et al.
    Versatile gene-specific sequence tags for Arabidopsis functional genomics: transcript profiling and reverse genetics applications.
    Genome Res., 2004. 14(10B): p. 2176-89
    [PMID:15489341]
  9. Nagata T,Yamada H,Du Z,Todoriki S,Kikuchi S
    Microarray analysis of genes that respond to gamma-irradiation in Arabidopsis.
    J. Agric. Food Chem., 2005. 53(4): p. 1022-30
    [PMID:15713015]
  10. Sharma N,Cram D,Huebert T,Zhou N,Parkin IA
    Exploiting the wild crucifer Thlaspi arvense to identify conserved and novel genes expressed during a plant's response to cold stress.
    Plant Mol. Biol., 2007. 63(2): p. 171-84
    [PMID:16972165]
  11. Mitra SK,Gantt JA,Ruby JF,Clouse SD,Goshe MB
    Membrane proteomic analysis of Arabidopsis thaliana using alternative solubilization techniques.
    J. Proteome Res., 2007. 6(5): p. 1933-50
    [PMID:17432890]
  12. Khanna R, et al.
    The Arabidopsis B-box zinc finger family.
    Plant Cell, 2009. 21(11): p. 3416-20
    [PMID:19920209]