PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID AT1G22640.1
Common NameATMYB3, F12K8.1, MYB3, T22J18.19
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis
Family MYB
Protein Properties Length: 257aa    MW: 29352.1 Da    PI: 7.6605
Description myb domain protein 3
Gene Model
Gene Model ID Type Source Coding Sequence
AT1G22640.1genomeTAIRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding59.76.2e-191461148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     +g+WT+eEd+llvd+++++G g+W++ +r  g+ R++k+c++rw +yl
      AT1G22640.1 14 KGAWTKEEDQLLVDYIRKHGEGCWRSLPRAAGLQRCGKSCRLRWMNYL 61
                     79********************************************97 PP

2Myb_DNA-binding60.14.7e-1967111147
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                      rg++T+eEdel+++++ +lG++ W++Ia +++ gRt++++k++w+++
      AT1G22640.1  67 RGNFTEEEDELIIKLHSLLGNK-WSLIAGRLP-GRTDNEIKNYWNTH 111
                      89********************.*********.************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.605.3E-25564IPR009057Homeodomain-like
PROSITE profilePS5129418.153961IPR017930Myb domain
SuperFamilySSF466892.08E-3112108IPR009057Homeodomain-like
SMARTSM007172.6E-141363IPR001005SANT/Myb domain
PfamPF002491.4E-161461IPR001005SANT/Myb domain
CDDcd001672.55E-111661No hitNo description
PROSITE profilePS5129429.42762116IPR017930Myb domain
Gene3DG3DSA:1.10.10.609.2E-2965116IPR009057Homeodomain-like
SMARTSM007174.6E-1866114IPR001005SANT/Myb domain
PfamPF002493.1E-1767111IPR001005SANT/Myb domain
CDDcd001671.88E-1269112No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006357Biological Processregulation of transcription from RNA polymerase II promoter
GO:0009611Biological Processresponse to wounding
GO:0009651Biological Processresponse to salt stress
GO:0009737Biological Processresponse to abscisic acid
GO:0009751Biological Processresponse to salicylic acid
GO:0009800Biological Processcinnamic acid biosynthetic process
GO:0009892Biological Processnegative regulation of metabolic process
GO:0030154Biological Processcell differentiation
GO:0005634Cellular Componentnucleus
GO:0000981Molecular FunctionRNA polymerase II transcription factor activity, sequence-specific DNA binding
GO:0001135Molecular Functiontranscription factor activity, RNA polymerase II transcription factor recruiting
GO:0043565Molecular Functionsequence-specific DNA binding
GO:0044212Molecular Functiontranscription regulatory region DNA binding
Plant Ontology ? help Back to Top
PO Term PO Category PO Description
PO:0000013anatomycauline leaf
PO:0000037anatomyshoot apex
PO:0000230anatomyinflorescence meristem
PO:0000293anatomyguard cell
PO:0008019anatomyleaf lamina base
PO:0009001anatomyfruit
PO:0009005anatomyroot
PO:0009006anatomyshoot system
PO:0009009anatomyplant embryo
PO:0009010anatomyseed
PO:0009025anatomyvascular leaf
PO:0009029anatomystamen
PO:0009030anatomycarpel
PO:0009031anatomysepal
PO:0009032anatomypetal
PO:0009046anatomyflower
PO:0009047anatomystem
PO:0009052anatomyflower pedicel
PO:0020030anatomycotyledon
PO:0020038anatomypetiole
PO:0020100anatomyhypocotyl
PO:0020137anatomyleaf apex
PO:0025022anatomycollective leaf structure
PO:0025281anatomypollen
PO:0001054developmental stagevascular leaf senescent stage
PO:0001078developmental stageplant embryo cotyledonary stage
PO:0001081developmental stagemature plant embryo stage
PO:0001185developmental stageplant embryo globular stage
PO:0004507developmental stageplant embryo bilateral stage
PO:0007064developmental stageLP.12 twelve leaves visible stage
PO:0007095developmental stageLP.08 eight leaves visible stage
PO:0007098developmental stageLP.02 two leaves visible stage
PO:0007103developmental stageLP.10 ten leaves visible stage
PO:0007115developmental stageLP.04 four leaves visible stage
PO:0007123developmental stageLP.06 six leaves visible stage
PO:0007611developmental stagepetal differentiation and expansion stage
PO:0007616developmental stageflowering stage
Sequence ? help Back to Top
Protein Sequence    Length: 257 aa     Download sequence    Send to blast
MGRSPCCEKA HMNKGAWTKE EDQLLVDYIR KHGEGCWRSL PRAAGLQRCG KSCRLRWMNY  60
LRPDLKRGNF TEEEDELIIK LHSLLGNKWS LIAGRLPGRT DNEIKNYWNT HIKRKLLSRG  120
IDPNSHRLIN ESVVSPSSLQ NDVVETIHLD FSGPVKPEPV REEIGMVNNC ESSGTTSEKD  180
YGNEEDWVLN LELSVGPSYR YESTRKVSVV DSAESTRRWG SELFGAHESD AVCLCCRIGL  240
FRNESCRNCR VSDVRTH
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A3e-30141167108B-MYB
1h8a_C4e-301211625128MYB TRANSFORMING PROTEIN
Search in ModeBase
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
At.232770.0floral meristem| flower| silique
Expression -- Microarray ? help Back to Top
Source ID E-value
GEO1453360210.0
Genevisible264210_at0.0
Expression AtlasAT1G22640-
AtGenExpressAT1G22640-
ATTED-IIAT1G22640-
Expression -- Description ? help Back to Top
Source Description
UniprotTISSUE SPECIFICITY: Expressed in roots, stems, leaves, flowers and siliques. {ECO:0000269|PubMed:9839469}.
Functional Description ? help Back to Top
Source Description
TAIRMYB-type transcription factor (MYB3) that represses phenylpropanoid biosynthesis gene expression
Function -- GeneRIF ? help Back to Top
  1. LNK1 and LNK2 act as transcriptional corepressors necessary for expression of the phenylpropanoids biosynthesis gene C4H through recruitment to its promoter via interaction with MYB3.
    [PMID: 28483877]
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00053PBM25215497Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMapAT1G22640.1
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: By nitrogen, salicylic acid, NaCl and abscisic acid (ABA). {ECO:0000269|PubMed:16463103, ECO:0000269|PubMed:18541146, ECO:0000269|PubMed:9839469}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Regulation -- ATRM (Manually Curated Upstream Regulators) ? help Back to Top
Source Upstream Regulator (A: Activate/R: Repress)
ATRM AT1G56650 (A)
Regulation -- Hormone ? help Back to Top
Source Hormone
AHDabscisic acid, auxin, ethylene, gibberellin, jasmonic acid, salicylic acid
Interaction ? help Back to Top
Source Intact With
IntActSearch Q9S9K9
Phenotype -- Mutation ? help Back to Top
Source ID
T-DNA ExpressAT1G22640
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAY0725430.0AY072543.1 Arabidopsis thaliana At1g22640/F12K8.1 mRNA, complete cds.
GenBankBT0008410.0BT000841.1 Arabidopsis thaliana At1g22640/F12K8.1 mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_564176.20.0myb domain protein 3
SwissprotQ9S9K90.0MYB3_ARATH; Transcription factor MYB3
TrEMBLA0A178WFN10.0A0A178WFN1_ARATH; MYB3
STRINGAT1G22640.10.0(Arabidopsis thaliana)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM4282646
Representative plantOGRP5171784
Publications ? help Back to Top
  1. Riechmann JL, et al.
    Arabidopsis transcription factors: genome-wide comparative analysis among eukaryotes.
    Science, 2000. 290(5499): p. 2105-10
    [PMID:11118137]
  2. Stracke R,Werber M,Weisshaar B
    The R2R3-MYB gene family in Arabidopsis thaliana.
    Curr. Opin. Plant Biol., 2001. 4(5): p. 447-56
    [PMID:11597504]
  3. Cheong YH, et al.
    Transcriptional profiling reveals novel interactions between wounding, pathogen, abiotic stress, and hormonal responses in Arabidopsis.
    Plant Physiol., 2002. 129(2): p. 661-77
    [PMID:12068110]
  4. R
    Rapid identification of Arabidopsis insertion mutants by non-radioactive detection of T-DNA tagged genes.
    Plant J., 2002. 32(2): p. 243-53
    [PMID:12383089]
  5. Yamada K, et al.
    Empirical analysis of transcriptional activity in the Arabidopsis genome.
    Science, 2003. 302(5646): p. 842-6
    [PMID:14593172]
  6. Tepperman JM, et al.
    Expression profiling of phyB mutant demonstrates substantial contribution of other phytochromes to red-light-regulated gene expression during seedling de-etiolation.
    Plant J., 2004. 38(5): p. 725-39
    [PMID:15144375]
  7. De Paepe A,Vuylsteke M,Van Hummelen P,Zabeau M,Van Der Straeten D
    Transcriptional profiling by cDNA-AFLP and microarray analysis reveals novel insights into the early response to ethylene in Arabidopsis.
    Plant J., 2004. 39(4): p. 537-59
    [PMID:15272873]
  8. Rogers LA, et al.
    Comparison of lignin deposition in three ectopic lignification mutants.
    New Phytol., 2005. 168(1): p. 123-40
    [PMID:16159327]
  9. Coupe SA, et al.
    Systemic signalling of environmental cues in Arabidopsis leaves.
    J. Exp. Bot., 2006. 57(2): p. 329-41
    [PMID:16330523]
  10. Yanhui C, et al.
    The MYB transcription factor superfamily of Arabidopsis: expression analysis and phylogenetic comparison with the rice MYB family.
    Plant Mol. Biol., 2006. 60(1): p. 107-24
    [PMID:16463103]
  11. Mandaokar A, et al.
    Transcriptional regulators of stamen development in Arabidopsis identified by transcriptional profiling.
    Plant J., 2006. 46(6): p. 984-1008
    [PMID:16805732]
  12. Cao D,Cheng H,Wu W,Soo HM,Peng J
    Gibberellin mobilizes distinct DELLA-dependent transcriptomes to regulate seed germination and floral development in Arabidopsis.
    Plant Physiol., 2006. 142(2): p. 509-25
    [PMID:16920880]
  13. Goeres DC, et al.
    Components of the Arabidopsis mRNA decapping complex are required for early seedling development.
    Plant Cell, 2007. 19(5): p. 1549-64
    [PMID:17513503]
  14. Dubos C, et al.
    MYBL2 is a new regulator of flavonoid biosynthesis in Arabidopsis thaliana.
    Plant J., 2008. 55(6): p. 940-53
    [PMID:18532978]
  15. Bang WY,Kim SW,Jeong IS,Koiwa H,Bahk JD
    The C-terminal region (640-967) of Arabidopsis CPL1 interacts with the abiotic stress- and ABA-responsive transcription factors.
    Biochem. Biophys. Res. Commun., 2008. 372(4): p. 907-12
    [PMID:18541146]
  16. Agudelo-Romero P, et al.
    Changes in the gene expression profile of Arabidopsis thaliana after infection with Tobacco etch virus.
    Virol. J., 2008. 5: p. 92
    [PMID:18684336]
  17. Rowan DD, et al.
    Environmental regulation of leaf colour in red 35S:PAP1 Arabidopsis thaliana.
    New Phytol., 2009. 182(1): p. 102-15
    [PMID:19192188]
  18. Arabidopsis Interactome Mapping Consortium
    Evidence for network evolution in an Arabidopsis interactome map.
    Science, 2011. 333(6042): p. 601-7
    [PMID:21798944]
  19. Tominaga-Wada R,Nukumizu Y
    Expression analysis of an R3-Type MYB transcription factor CPC-LIKE MYB4 (TRICHOMELESS2) and CPL4-Related transcripts in Arabidopsis.
    Int J Mol Sci, 2012. 13(3): p. 3478-91
    [PMID:22489163]
  20. Ding Y, et al.
    Four distinct types of dehydration stress memory genes in Arabidopsis thaliana.
    BMC Plant Biol., 2013. 13: p. 229
    [PMID:24377444]
  21. Jin J, et al.
    An Arabidopsis Transcriptional Regulatory Map Reveals Distinct Functional and Evolutionary Features of Novel Transcription Factors.
    Mol. Biol. Evol., 2015. 32(7): p. 1767-73
    [PMID:25750178]
  22. Zhou M, et al.
    Changing a conserved amino acid in R2R3-MYB transcription repressors results in cytoplasmic accumulation and abolishes their repressive activity in Arabidopsis.
    Plant J., 2015. 84(2): p. 395-403
    [PMID:26332741]
  23. Wada T,Hayashi N,Tominaga-Wada R
    Root hair formation at the root-hypocotyl junction in CPC-LIKE MYB double and triple mutants of Arabidopsis.
    Plant Signal Behav, 2015. 10(11): p. e1089372
    [PMID:26339713]
  24. Wada T,Tominaga-Wada R
    CAPRICE family genes control flowering time through both promoting and repressing CONSTANS and FLOWERING LOCUS T expression.
    Plant Sci., 2015. 241: p. 260-5
    [PMID:26706076]
  25. Song L, et al.
    A transcription factor hierarchy defines an environmental stress response network.
    Science, 2017.
    [PMID:27811239]
  26. Zhou M, et al.
    LNK1 and LNK2 Corepressors Interact with the MYB3 Transcription Factor in Phenylpropanoid Biosynthesis.
    Plant Physiol., 2017. 174(3): p. 1348-1358
    [PMID:28483877]
  27. Mondal SK,Roy S
    Genome-wide sequential, evolutionary, organizational and expression analyses of phenylpropanoid biosynthesis associated MYB domain transcription factors in Arabidopsis.
    J. Biomol. Struct. Dyn., 2018. 36(6): p. 1577-1601
    [PMID:28490275]
  28. Kranz HD, et al.
    Towards functional characterisation of the members of the R2R3-MYB gene family from Arabidopsis thaliana.
    Plant J., 1998. 16(2): p. 263-76
    [PMID:9839469]