PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID AT1G22590.2
Common NameAGL87
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis
Family M-type_MADS
Protein Properties Length: 163aa    MW: 18702.9 Da    PI: 9.9468
Description AGAMOUS-like 87
Gene Model
Gene Model ID Type Source Coding Sequence
AT1G22590.2genomeTAIRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF48.41.2e-151150342
                 --SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-T CS
       SRF-TF  3 ienksnrqvtfskRrngilKKAeELSvLCdaevaviifss 42
                 i+++  r vtf kR+ g+lKK +EL vLC+  ++ ii+s+
  AT1G22590.2 11 ISDNATRRVTFRKRKDGLLKKIYELTVLCGLPACAIIYSE 50
                 899999*********************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM004329.3E-18160IPR002100Transcription factor, MADS-box
PROSITE profilePS5006618.166150IPR002100Transcription factor, MADS-box
CDDcd002664.62E-20285No hitNo description
SuperFamilySSF554553.01E-21294IPR002100Transcription factor, MADS-box
PRINTSPR004045.8E-9323IPR002100Transcription factor, MADS-box
PfamPF003196.8E-151150IPR002100Transcription factor, MADS-box
PRINTSPR004045.8E-92338IPR002100Transcription factor, MADS-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0046983Molecular Functionprotein dimerization activity
Plant Ontology ? help Back to Top
PO Term PO Category PO Description
PO:0000013anatomycauline leaf
PO:0000037anatomyshoot apex
PO:0000230anatomyinflorescence meristem
PO:0000293anatomyguard cell
PO:0008019anatomyleaf lamina base
PO:0009001anatomyfruit
PO:0009006anatomyshoot system
PO:0009009anatomyplant embryo
PO:0009010anatomyseed
PO:0009025anatomyvascular leaf
PO:0009029anatomystamen
PO:0009030anatomycarpel
PO:0009031anatomysepal
PO:0009032anatomypetal
PO:0009046anatomyflower
PO:0009047anatomystem
PO:0009052anatomyflower pedicel
PO:0009062anatomygynoecium
PO:0020030anatomycotyledon
PO:0020038anatomypetiole
PO:0020137anatomyleaf apex
PO:0025022anatomycollective leaf structure
PO:0025034anatomyleaf
PO:0001054developmental stagevascular leaf senescent stage
PO:0001078developmental stageplant embryo cotyledonary stage
PO:0001081developmental stagemature plant embryo stage
PO:0001185developmental stageplant embryo globular stage
PO:0004507developmental stageplant embryo bilateral stage
PO:0007064developmental stageLP.12 twelve leaves visible stage
PO:0007095developmental stageLP.08 eight leaves visible stage
PO:0007098developmental stageLP.02 two leaves visible stage
PO:0007103developmental stageLP.10 ten leaves visible stage
PO:0007115developmental stageLP.04 four leaves visible stage
PO:0007123developmental stageLP.06 six leaves visible stage
PO:0007611developmental stagepetal differentiation and expansion stage
PO:0007616developmental stageflowering stage
Sequence ? help Back to Top
Protein Sequence    Length: 163 aa     Download sequence    Send to blast
MGRRKVTHQL ISDNATRRVT FRKRKDGLLK KIYELTVLCG LPACAIIYSE YKDGPELWPN  60
LNEVRSILNR LSELPVEKQT KYMMDQKDLM NKMIQDAEKK LEKEKMHTRA MKLGLMAGSN  120
DLITDTDCSE ELARAADVVD KKLKAIRERI KAVEAGAPII KRD
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1224RRKVTHQLISDNATRRVTFRKRK
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
At.415920.0flower
Expression -- Microarray ? help Back to Top
Source ID E-value
Genevisible261942_at1e-156
Expression AtlasAT1G22590-
AtGenExpressAT1G22590-
ATTED-IIAT1G22590-
Cis-element ? help Back to Top
SourceLink
PlantRegMapAT1G22590.2
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Interaction ? help Back to Top
Source Intact With
BioGRIDAT1G46408, AT1G48150
Phenotype -- Mutation ? help Back to Top
Source ID
T-DNA ExpressAT1G22590
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC0065510.0AC006551.6 Arabidopsis thaliana chromosome I BAC F12K8 genomic sequence, complete sequence.
GenBankAY1412500.0AY141250.1 Arabidopsis thaliana MADS-box protein AGL87 mRNA, complete cds.
GenBankCP0026840.0CP002684.1 Arabidopsis thaliana chromosome 1 sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_001319062.11e-117AGAMOUS-like 87
TrEMBLQ7X9H11e-115Q7X9H1_ARATH; AGAMOUS-like 87
STRINGAT1G22590.21e-116(Arabidopsis thaliana)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM7028415
Representative plantOGRP11413173
Publications ? help Back to Top
  1. Riechmann JL, et al.
    Arabidopsis transcription factors: genome-wide comparative analysis among eukaryotes.
    Science, 2000. 290(5499): p. 2105-10
    [PMID:11118137]
  2. De Bodt S, et al.
    Genomewide structural annotation and evolutionary analysis of the type I MADS-box genes in plants.
    J. Mol. Evol., 2003. 56(5): p. 573-86
    [PMID:12698294]
  3. Parenicov√° L, et al.
    Molecular and phylogenetic analyses of the complete MADS-box transcription factor family in Arabidopsis: new openings to the MADS world.
    Plant Cell, 2003. 15(7): p. 1538-51
    [PMID:12837945]
  4. De Bodt S,Raes J,Van de Peer Y,Theissen G
    And then there were many: MADS goes genomic.
    Trends Plant Sci., 2003. 8(10): p. 475-83
    [PMID:14557044]
  5. Sottosanto JB,Gelli A,Blumwald E
    DNA array analyses of Arabidopsis thaliana lacking a vacuolar Na+/H+ antiporter: impact of AtNHX1 on gene expression.
    Plant J., 2004. 40(5): p. 752-71
    [PMID:15546358]
  6. de Folter S, et al.
    Comprehensive interaction map of the Arabidopsis MADS Box transcription factors.
    Plant Cell, 2005. 17(5): p. 1424-33
    [PMID:15805477]
  7. Pina C,Pinto F,Feij
    Gene family analysis of the Arabidopsis pollen transcriptome reveals biological implications for cell growth, division control, and gene expression regulation.
    Plant Physiol., 2005. 138(2): p. 744-56
    [PMID:15908605]
  8. Ascencio-Ib
    Global analysis of Arabidopsis gene expression uncovers a complex array of changes impacting pathogen response and cell cycle during geminivirus infection.
    Plant Physiol., 2008. 148(1): p. 436-54
    [PMID:18650403]
  9. Bemer M,Heijmans K,Airoldi C,Davies B,Angenent GC
    An atlas of type I MADS box gene expression during female gametophyte and seed development in Arabidopsis.
    Plant Physiol., 2010. 154(1): p. 287-300
    [PMID:20631316]