PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID AT1G22130.1
Common NameAGL104, F2E2.20
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis
Family MIKC_MADS
Protein Properties Length: 335aa    MW: 38278.7 Da    PI: 4.6411
Description AGAMOUS-like 104
Gene Model
Gene Model ID Type Source Coding Sequence
AT1G22130.1genomeTAIRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF84.37.5e-27958150
                 S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE CS
       SRF-TF  1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeys 50
                 krien++nrqvtfskRrng++KKA+ELS+LCd+++a+i+fs++++l  +s
  AT1G22130.1  9 KRIENTTNRQVTFSKRRNGLIKKAYELSILCDIDIALIMFSPSDRLSLFS 58
                 79******************************************998776 PP

2K-box19.25.2e-081221911079
        K-box  10 eeakaeslqqelakLkkeienLqreqRhllGedLesLslkeLqqLeqqLekslkkiRskKnellleqiee 79 
                   +++ e+l++e+ +L++++++ ++e+R++  + +   +++e +  e+qL + l+++ +++++l+ ++++ 
  AT1G22130.1 122 INSDVEELEHEVCRLQQQLQMAEEELRRYEPDPIRFTTMEEYEVSEKQLLDTLTHVVQRRDHLMSNHLSS 191
                  5678999**********************************************************99875 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5006628.973161IPR002100Transcription factor, MADS-box
SMARTSM004323.0E-36160IPR002100Transcription factor, MADS-box
CDDcd002655.99E-34275No hitNo description
SuperFamilySSF554557.72E-29282IPR002100Transcription factor, MADS-box
PRINTSPR004049.9E-25323IPR002100Transcription factor, MADS-box
PROSITE patternPS003500357IPR002100Transcription factor, MADS-box
PfamPF003191.3E-241055IPR002100Transcription factor, MADS-box
PRINTSPR004049.9E-252338IPR002100Transcription factor, MADS-box
PRINTSPR004049.9E-253859IPR002100Transcription factor, MADS-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0010152Biological Processpollen maturation
GO:0080092Biological Processregulation of pollen tube growth
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0005515Molecular Functionprotein binding
GO:0046983Molecular Functionprotein dimerization activity
Plant Ontology ? help Back to Top
PO Term PO Category PO Description
PO:0009031anatomysepal
PO:0009032anatomypetal
PO:0009046anatomyflower
PO:0025022anatomycollective leaf structure
PO:0025195anatomypollen tube cell
PO:0025281anatomypollen
PO:0001016developmental stageL mature pollen stage
PO:0001017developmental stageM germinated pollen stage
PO:0007611developmental stagepetal differentiation and expansion stage
PO:0007616developmental stageflowering stage
Sequence ? help Back to Top
Protein Sequence    Length: 335 aa     Download sequence    Send to blast
MGRVKLEIKR IENTTNRQVT FSKRRNGLIK KAYELSILCD IDIALIMFSP SDRLSLFSGK  60
TRIEDVFSRF INLPKQERES ALYFPDQNRR PDIQNKECLL RILQQLKTEN DIALQVTNPA  120
AINSDVEELE HEVCRLQQQL QMAEEELRRY EPDPIRFTTM EEYEVSEKQL LDTLTHVVQR  180
RDHLMSNHLS SYEASTMQPN IGGPFVNDVV EGWLPENGTN QTHLFDASAH SNQLRELSSA  240
MYEPLLQGSS SSSNQNNMSE CHVTNHNGEM FPEWAQAYSS SALFASMQQQ HEGVGPSIEE  300
MMPAQQSDIP GVTAETQVDH EVSDYETKVP QLSSQ
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3mu6_A1e-15254153Myocyte-specific enhancer factor 2A
3mu6_B1e-15254153Myocyte-specific enhancer factor 2A
3mu6_C1e-15254153Myocyte-specific enhancer factor 2A
3mu6_D1e-15254153Myocyte-specific enhancer factor 2A
6bz1_A3e-15190191MEF2 CHIMERA
6bz1_B3e-15190191MEF2 CHIMERA
6bz1_C3e-15190191MEF2 CHIMERA
6bz1_D3e-15190191MEF2 CHIMERA
Search in ModeBase
Expression -- Microarray ? help Back to Top
Source ID E-value
Genevisible255952_at0.0
Expression AtlasAT1G22130-
AtGenExpressAT1G22130-
ATTED-IIAT1G22130-
Expression -- Description ? help Back to Top
Source Description
UniprotTISSUE SPECIFICITY: Expressed in pollen. {ECO:0000269|PubMed:12949148}.
Functional Description ? help Back to Top
Source Description
TAIREncodes a member of the MIKC (MADS box, Keratin binding domain, and C terminal domain containing )family of transcriptional regulators. AGL104 is expressed in pollen.It forms heterodimers with other MICK family members (AGL65 and AGL30). Involved in late stages of pollen development and pollen tube growth.
UniProtProbable transcription factor that forms heterodimers with the MADS-box proteins AGL30 and AGL65 and is involved in the regulation of pollen maturation at the late stages of pollen development and pollen tube growth. {ECO:0000269|PubMed:19211705}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapAT1G22130.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Interaction ? help Back to Top
Source Intact With
BioGRIDAT1G46408
Phenotype -- Disruption Phenotype ? help Back to Top
Source Description
UniProtDISRUPTION PHENOTYPE: No visible phenotype under normal growth conditions. Pollen grains from the double mutant agl66 and agl104 have severely reduced viability, delayed germination and aberrant pollen tube growth. {ECO:0000269|PubMed:19211705}.
Phenotype -- Mutation ? help Back to Top
Source ID
T-DNA ExpressAT1G22130
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankDQ0564570.0DQ056457.1 Arabidopsis thaliana MADS-box family protein (At1g22130) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_173632.10.0AGAMOUS-like 104
SwissprotQ9LM460.0AG104_ARATH; Agamous-like MADS-box protein AGL104
TrEMBLA0A178W4Y80.0A0A178W4Y8_ARATH; AGL104
STRINGAT1G22130.10.0(Arabidopsis thaliana)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM21792365
Representative plantOGRP1617761
Publications ? help Back to Top
  1. Riechmann JL, et al.
    Arabidopsis transcription factors: genome-wide comparative analysis among eukaryotes.
    Science, 2000. 290(5499): p. 2105-10
    [PMID:11118137]
  2. De Bodt S, et al.
    Genomewide structural annotation and evolutionary analysis of the type I MADS-box genes in plants.
    J. Mol. Evol., 2003. 56(5): p. 573-86
    [PMID:12698294]
  3. Parenicov√° L, et al.
    Molecular and phylogenetic analyses of the complete MADS-box transcription factor family in Arabidopsis: new openings to the MADS world.
    Plant Cell, 2003. 15(7): p. 1538-51
    [PMID:12837945]
  4. Kofuji R, et al.
    Evolution and divergence of the MADS-box gene family based on genome-wide expression analyses.
    Mol. Biol. Evol., 2003. 20(12): p. 1963-77
    [PMID:12949148]
  5. Scheible WR, et al.
    Genome-wide reprogramming of primary and secondary metabolism, protein synthesis, cellular growth processes, and the regulatory infrastructure of Arabidopsis in response to nitrogen.
    Plant Physiol., 2004. 136(1): p. 2483-99
    [PMID:15375205]
  6. de Folter S, et al.
    Comprehensive interaction map of the Arabidopsis MADS Box transcription factors.
    Plant Cell, 2005. 17(5): p. 1424-33
    [PMID:15805477]
  7. Pina C,Pinto F,Feij
    Gene family analysis of the Arabidopsis pollen transcriptome reveals biological implications for cell growth, division control, and gene expression regulation.
    Plant Physiol., 2005. 138(2): p. 744-56
    [PMID:15908605]
  8. Verelst W,Saedler H,M√ľnster T
    MIKC* MADS-protein complexes bind motifs enriched in the proximal region of late pollen-specific Arabidopsis promoters.
    Plant Physiol., 2007. 143(1): p. 447-60
    [PMID:17071640]
  9. Underwood BA,Vanderhaeghen R,Whitford R,Town CD,Hilson P
    Simultaneous high-throughput recombinational cloning of open reading frames in closed and open configurations.
    Plant Biotechnol. J., 2006. 4(3): p. 317-24
    [PMID:17147637]
  10. Wang Y, et al.
    Transcriptome analyses show changes in gene expression to accompany pollen germination and tube growth in Arabidopsis.
    Plant Physiol., 2008. 148(3): p. 1201-11
    [PMID:18775970]
  11. Adamczyk BJ,Fernandez DE
    MIKC* MADS domain heterodimers are required for pollen maturation and tube growth in Arabidopsis.
    Plant Physiol., 2009. 149(4): p. 1713-23
    [PMID:19211705]
  12. Hanada K, et al.
    Functional compensation of primary and secondary metabolites by duplicate genes in Arabidopsis thaliana.
    Mol. Biol. Evol., 2011. 28(1): p. 377-82
    [PMID:20736450]
  13. Xia C, et al.
    The ARID-HMG DNA-binding protein AtHMGB15 is required for pollen tube growth in Arabidopsis thaliana.
    Plant J., 2014. 79(5): p. 741-56
    [PMID:24923357]
  14. Zhang S, et al.
    FERTILIZATION-INDEPENDENT SEED-Polycomb Repressive Complex 2 Plays a Dual Role in Regulating Type I MADS-Box Genes in Early Endosperm Development.
    Plant Physiol., 2018. 177(1): p. 285-299
    [PMID:29523711]