PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID AT1G21450.1
Common NameF24J8.8, SCL1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis
Family GRAS
Protein Properties Length: 593aa    MW: 66700.4 Da    PI: 4.7427
Description SCARECROW-like 1
Gene Model
Gene Model ID Type Source Coding Sequence
AT1G21450.1genomeTAIRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS444.66.9e-1362245933374
         GRAS   3 elLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlarsvselykalppsetseknsseelaalklfsevsPilkfshltaNq 100
                  + L++cA+a+s+g+le+a +++++l++++s +gdp qR+aay++e+Laar+a s++ +y+al+++e +   s+e+laa+++++ev+P++kf++l+aN 
  AT1G21450.1 224 QILISCARALSEGKLEEALSMVNELRQIVSIQGDPSQRIAAYMVEGLAARMAASGKFIYRALKCKEPP---SDERLAAMQVLFEVCPCFKFGFLAANG 318
                  78*****************************************************************9...9************************** PP

         GRAS 101 aIleavegeervHiiDfdisqGlQWpaLlqaLasRpegppslRiTgvgspesg..skeeleetgerLakfAeelgvpfefnvlvakrledleleeLrv 196
                  aIlea++gee+vHiiDfdi+qG Q+++L++++a+ p++ p+lR+Tg+++pes+  s   l+ +g rL+++Ae  gv+f+f++ + ++++ +++++L +
  AT1G21450.1 319 AILEAIKGEEEVHIIDFDINQGNQYMTLIRSIAELPGKRPRLRLTGIDDPESVqrSIGGLRIIGLRLEQLAEDNGVSFKFKA-MPSKTSIVSPSTLGC 415
                  ***************************************************9988899************************.8************** PP

         GRAS 197 kpgEalaVnlvlqlhrlldesvsleserdevLklvkslsPkvvvvveqeadhnsesFlerflealeyysalfdsleaklpreseerikvErellgrei 294
                  kpgE+l+Vn+++qlh+++desv++ ++rde+L++vksl+Pk+v+vveq++++n+++F+ rf+ea eyysa+f+sl+++lpres+er++vEr++l+r+i
  AT1G21450.1 416 KPGETLIVNFAFQLHHMPDESVTTVNQRDELLHMVKSLNPKLVTVVEQDVNTNTSPFFPRFIEAYEYYSAVFESLDMTLPRESQERMNVERQCLARDI 513
                  ************************************************************************************************** PP

         GRAS 295 vnvvacegaerrerhetlekWrerleeaGFkpvplsekaakqaklllrkvksdgyrveeesgslvlgWkdrpLvsvSaWr 374
                  vn+vaceg+er+er e ++kWr+r+++aGF+p p+s k++++++ l+++ + + y+++ee g+l ++W++++L+++SaWr
  AT1G21450.1 514 VNIVACEGEERIERYEAAGKWRARMMMAGFNPKPMSAKVTNNIQNLIKQQYCNKYKLKEEMGELHFCWEEKSLIVASAWR 593
                  ***************************************************888*************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098564.767196573IPR005202Transcription factor GRAS
PfamPF035142.4E-133224593IPR005202Transcription factor GRAS
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Plant Ontology ? help Back to Top
PO Term PO Category PO Description
PO:0000013anatomycauline leaf
PO:0000037anatomyshoot apex
PO:0000230anatomyinflorescence meristem
PO:0000293anatomyguard cell
PO:0008019anatomyleaf lamina base
PO:0009005anatomyroot
PO:0009006anatomyshoot system
PO:0009009anatomyplant embryo
PO:0009010anatomyseed
PO:0009025anatomyvascular leaf
PO:0009029anatomystamen
PO:0009030anatomycarpel
PO:0009031anatomysepal
PO:0009032anatomypetal
PO:0009046anatomyflower
PO:0009047anatomystem
PO:0009052anatomyflower pedicel
PO:0020030anatomycotyledon
PO:0020038anatomypetiole
PO:0020100anatomyhypocotyl
PO:0020137anatomyleaf apex
PO:0025022anatomycollective leaf structure
PO:0025281anatomypollen
PO:0001054developmental stagevascular leaf senescent stage
PO:0001078developmental stageplant embryo cotyledonary stage
PO:0001081developmental stagemature plant embryo stage
PO:0001185developmental stageplant embryo globular stage
PO:0004507developmental stageplant embryo bilateral stage
PO:0007064developmental stageLP.12 twelve leaves visible stage
PO:0007095developmental stageLP.08 eight leaves visible stage
PO:0007098developmental stageLP.02 two leaves visible stage
PO:0007103developmental stageLP.10 ten leaves visible stage
PO:0007115developmental stageLP.04 four leaves visible stage
PO:0007123developmental stageLP.06 six leaves visible stage
PO:0007131developmental stageseedling development stage
PO:0007611developmental stagepetal differentiation and expansion stage
PO:0007616developmental stageflowering stage
Sequence ? help Back to Top
Protein Sequence    Length: 593 aa     Download sequence    Send to blast
MVEQTVVREH IKARVMSLVR SAEPSSYRNP KLYTLNENGN NNGVSSAQIF DPDRSKNPCL  60
TDDSYPSQSY EKYFLDSPTD EFVQHPIGSG ASVSSFGSLD SFPYQSRPVL GCSMEFQLPL  120
DSTSTSSTRL LGDYQAVSYS PSMDVVEEFD DEQMRSKIQE LERALLGDED DKMVGIDNLM  180
EIDSEWSYQN ESEQHQDSPK ESSSADSNSH VSSKEVVSQA TPKQILISCA RALSEGKLEE  240
ALSMVNELRQ IVSIQGDPSQ RIAAYMVEGL AARMAASGKF IYRALKCKEP PSDERLAAMQ  300
VLFEVCPCFK FGFLAANGAI LEAIKGEEEV HIIDFDINQG NQYMTLIRSI AELPGKRPRL  360
RLTGIDDPES VQRSIGGLRI IGLRLEQLAE DNGVSFKFKA MPSKTSIVSP STLGCKPGET  420
LIVNFAFQLH HMPDESVTTV NQRDELLHMV KSLNPKLVTV VEQDVNTNTS PFFPRFIEAY  480
EYYSAVFESL DMTLPRESQE RMNVERQCLA RDIVNIVACE GEERIERYEA AGKWRARMMM  540
AGFNPKPMSA KVTNNIQNLI KQQYCNKYKL KEEMGELHFC WEEKSLIVAS AWR
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5hyz_A1e-562245936375GRAS family transcription factor containing p
Search in ModeBase
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
At.148250.0floral meristem| root
Expression -- Microarray ? help Back to Top
Source ID E-value
GEO1864787280.0
Genevisible260878_at0.0
Expression AtlasAT1G21450-
AtGenExpressAT1G21450-
ATTED-IIAT1G21450-
Expression -- Description ? help Back to Top
Source Description
UniprotTISSUE SPECIFICITY: Expressed in seedlings, roots, shoots, leaves, flowers and siliques. {ECO:0000269|PubMed:10341448, ECO:0000269|PubMed:18500650}.
Functional Description ? help Back to Top
Source Description
TAIREncodes a scarecrow-like protein (SCL1). Member of GRAS gene family.
UniProtProbable transcription factor involved in plant development. {ECO:0000250}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapAT1G21450.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Phenotype -- Mutation ? help Back to Top
Source ID
T-DNA ExpressAT1G21450
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC0154470.0AC015447.8 Arabidopsis thaliana chromosome I BAC F24J8 genomic sequence, complete sequence.
GenBankCP0026840.0CP002684.1 Arabidopsis thaliana chromosome 1 sequence.
GenBankAY0966260.0AY096626.1 Arabidopsis thaliana unknown protein (At1g21450) mRNA, complete cds.
GenBankAY0458330.0AY045833.1 Arabidopsis thaliana putative scarecrow 1 protein (At1g21450) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_173566.10.0scarecrow-like protein 1
SwissprotQ9SDQ30.0SCL1_ARATH; Scarecrow-like protein 1
TrEMBLD7KK120.0D7KK12_ARALL; Putative uncharacterized protein
STRINGAT1G21450.10.0(Arabidopsis thaliana)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM69532744
Representative plantOGRP82621116
Publications ? help Back to Top
  1. Pysh LD,Wysocka-Diller JW,Camilleri C,Bouchez D,Benfey PN
    The GRAS gene family in Arabidopsis: sequence characterization and basic expression analysis of the SCARECROW-LIKE genes.
    Plant J., 1999. 18(1): p. 111-9
    [PMID:10341448]
  2. Bolle C,Koncz C,Chua NH
    PAT1, a new member of the GRAS family, is involved in phytochrome A signal transduction.
    Genes Dev., 2000. 14(10): p. 1269-78
    [PMID:10817761]
  3. Riechmann JL, et al.
    Arabidopsis transcription factors: genome-wide comparative analysis among eukaryotes.
    Science, 2000. 290(5499): p. 2105-10
    [PMID:11118137]
  4. Menges M,Hennig L,Gruissem W,Murray JA
    Cell cycle-regulated gene expression in Arabidopsis.
    J. Biol. Chem., 2002. 277(44): p. 41987-2002
    [PMID:12169696]
  5. Yamada K, et al.
    Empirical analysis of transcriptional activity in the Arabidopsis genome.
    Science, 2003. 302(5646): p. 842-6
    [PMID:14593172]
  6. Bolle C
    The role of GRAS proteins in plant signal transduction and development.
    Planta, 2004. 218(5): p. 683-92
    [PMID:14760535]
  7. Tian C,Wan P,Sun S,Li J,Chen M
    Genome-wide analysis of the GRAS gene family in rice and Arabidopsis.
    Plant Mol. Biol., 2004. 54(4): p. 519-32
    [PMID:15316287]
  8. Gao MJ,Parkin I,Lydiate D,Hannoufa A
    An auxin-responsive SCARECROW-like transcriptional activator interacts with histone deacetylase.
    Plant Mol. Biol., 2004. 55(3): p. 417-31
    [PMID:15604690]
  9. Coupe SA, et al.
    Systemic signalling of environmental cues in Arabidopsis leaves.
    J. Exp. Bot., 2006. 57(2): p. 329-41
    [PMID:16330523]
  10. Andersson-Gunner
    Biosynthesis of cellulose-enriched tension wood in Populus: global analysis of transcripts and metabolites identifies biochemical and developmental regulators in secondary wall biosynthesis.
    Plant J., 2006. 45(2): p. 144-65
    [PMID:16367961]
  11. Pischke MS,Huttlin EL,Hegeman AD,Sussman MR
    A transcriptome-based characterization of habituation in plant tissue culture.
    Plant Physiol., 2006. 140(4): p. 1255-78
    [PMID:16489130]
  12. Lee MH, et al.
    Large-scale analysis of the GRAS gene family in Arabidopsis thaliana.
    Plant Mol. Biol., 2008. 67(6): p. 659-70
    [PMID:18500650]
  13. Ascencio-Ib
    Global analysis of Arabidopsis gene expression uncovers a complex array of changes impacting pathogen response and cell cycle during geminivirus infection.
    Plant Physiol., 2008. 148(1): p. 436-54
    [PMID:18650403]
  14. Efroni I, et al.
    Regulation of leaf maturation by chromatin-mediated modulation of cytokinin responses.
    Dev. Cell, 2013. 24(4): p. 438-45
    [PMID:23449474]