PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID AT1G21340.1
Common NameDOF1.2, F24J8.23
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis
Family Dof
Protein Properties Length: 260aa    MW: 29678.6 Da    PI: 4.4752
Description Dof family protein
Gene Model
Gene Model ID Type Source Coding Sequence
AT1G21340.1genomeTAIRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-Dof118.13.3e-373893661
       zf-Dof  6 lkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknkks 61
                  +cprC s+ntkfCyynnyslsqPryfCk+CrryWtkGG+lrn+PvGgg+rk+ +s
  AT1G21340.1 38 PACPRCASSNTKFCYYNNYSLSQPRYFCKGCRRYWTKGGSLRNIPVGGGCRKRSRS 93
                 57**************************************************9876 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
ProDomPD0074781.0E-253092IPR003851Zinc finger, Dof-type
PROSITE profilePS5088428.2863892IPR003851Zinc finger, Dof-type
PfamPF027011.8E-313992IPR003851Zinc finger, Dof-type
PROSITE patternPS0136104076IPR003851Zinc finger, Dof-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0046872Molecular Functionmetal ion binding
Sequence ? help Back to Top
Protein Sequence    Length: 260 aa     Download sequence    Send to blast
MLPYIGHNSY QQHQFPLPEM EIPEKWKLSY EQEAITAPAC PRCASSNTKF CYYNNYSLSQ  60
PRYFCKGCRR YWTKGGSLRN IPVGGGCRKR SRSRQNSHKR FGRNENRPDG LINQDDGFQS  120
SPPGSDIDLA AVFAQYVTDR SPSSTDNTTG SDQDSPITTT THALESLSWD ICQETDVDLG  180
FYGEFNNLTQ KTKEDQEVFG QFLQEDREEI FEFQGLLDDK EIQEILECSF SEEPDQLVSQ  240
GSFMINGDNW SSTDLTRFGI
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
18893KRSRSR
Expression -- Microarray ? help Back to Top
Source ID E-value
Genevisible260925_at0.0
Expression AtlasAT1G21340-
AtGenExpressAT1G21340-
ATTED-IIAT1G21340-
Functional Description ? help Back to Top
Source Description
UniProtTranscription factor that binds specifically to a 5'-AA[AG]G-3' consensus core sequence. {ECO:0000250}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapAT1G21340.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Phenotype -- Mutation ? help Back to Top
Source ID
T-DNA ExpressAT1G21340
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC0154470.0AC015447.8 Arabidopsis thaliana chromosome I BAC F24J8 genomic sequence, complete sequence.
GenBankCP0026840.0CP002684.1 Arabidopsis thaliana chromosome 1 sequence.
GenBankDQ4462680.0DQ446268.1 Arabidopsis thaliana clone pENTR221-At1g21340 Dof-type zinc finger domain-containing protein (At1g21340) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_173556.10.0Dof-type zinc finger DNA-binding family protein
SwissprotP683490.0DOF12_ARATH; Dof zinc finger protein DOF1.2
TrEMBLA0A384LHH80.0A0A384LHH8_ARATH; Uncharacterized protein
TrEMBLA0ME790.0A0ME79_ARATH; Uncharacterized protein (Fragment)
TrEMBLC0SUW90.0C0SUW9_ARATH; Uncharacterized protein At1g21340 (Fragment)
STRINGAT1G21340.10.0(Arabidopsis thaliana)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM64622643
Representative plantOGRP3817445
Publications ? help Back to Top
  1. Riechmann JL, et al.
    Arabidopsis transcription factors: genome-wide comparative analysis among eukaryotes.
    Science, 2000. 290(5499): p. 2105-10
    [PMID:11118137]
  2. Yanagisawa S
    The Dof family of plant transcription factors.
    Trends Plant Sci., 2002. 7(12): p. 555-60
    [PMID:12475498]
  3. Lijavetzky D,Carbonero P,Vicente-Carbajosa J
    Genome-wide comparative phylogenetic analysis of the rice and Arabidopsis Dof gene families.
    BMC Evol. Biol., 2003. 3: p. 17
    [PMID:12877745]
  4. Underwood BA,Vanderhaeghen R,Whitford R,Town CD,Hilson P
    Simultaneous high-throughput recombinational cloning of open reading frames in closed and open configurations.
    Plant Biotechnol. J., 2006. 4(3): p. 317-24
    [PMID:17147637]