PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID AT1G19700.2
Common NameBEL10, BLH10, F14P1.20, F6F9.25
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis
Family TALE
Protein Properties Length: 538aa    MW: 60636.1 Da    PI: 6.2898
Description BEL1-like homeodomain 10
Gene Model
Gene Model ID Type Source Coding Sequence
AT1G19700.2genomeTAIRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox30.75.4e-103714081954
                  HHH..SSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHH CS
     Homeobox  19 Fek..nrypsaeereeLAkklgLterqVkvWFqNrRak 54 
                  Fe   ++yp+++e+  LAk++gL+++qV +WF N R +
  AT1G19700.2 371 FEHflHPYPKESEKIMLAKQTGLSKNQVANWFINARVR 408
                  664459******************************88 PP

2BELL121.82.8e-39231302172
         BELL   1 erqelqkkkakLlslleeVdkrYkqyveqlqtvissFeavaglgsakpYtslAlkaiSrhFrcLkdaiaeqi 72 
                  er+elq+kk+kLl++++eVdkrY+qy++q+++++ssFe+vaglgsakpYts+Al++iSrhFr+L+dai+eqi
  AT1G19700.2 231 EREELQNKKNKLLTMVDEVDKRYNQYYHQMEALASSFEIVAGLGSAKPYTSVALNRISRHFRALRDAIKEQI 302
                  799********************************************************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM005745.6E-53160300IPR006563POX domain
PfamPF075263.3E-46166298IPR006563POX domain
PROSITE profilePS5007112.455349412IPR001356Homeobox domain
SMARTSM003895.4E-10352416IPR001356Homeobox domain
CDDcd000868.11E-12352413No hitNo description
SuperFamilySSF466891.75E-17353419IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.602.3E-28355418IPR009057Homeodomain-like
PfamPF059206.7E-18369408IPR008422Homeobox KN domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
Plant Ontology ? help Back to Top
PO Term PO Category PO Description
PO:0000013anatomycauline leaf
PO:0000037anatomyshoot apex
PO:0000230anatomyinflorescence meristem
PO:0000293anatomyguard cell
PO:0008019anatomyleaf lamina base
PO:0009005anatomyroot
PO:0009006anatomyshoot system
PO:0009009anatomyplant embryo
PO:0009010anatomyseed
PO:0009025anatomyvascular leaf
PO:0009029anatomystamen
PO:0009030anatomycarpel
PO:0009031anatomysepal
PO:0009032anatomypetal
PO:0009046anatomyflower
PO:0009047anatomystem
PO:0009052anatomyflower pedicel
PO:0020030anatomycotyledon
PO:0020100anatomyhypocotyl
PO:0025022anatomycollective leaf structure
PO:0025281anatomypollen
PO:0001054developmental stagevascular leaf senescent stage
PO:0001078developmental stageplant embryo cotyledonary stage
PO:0001185developmental stageplant embryo globular stage
PO:0004507developmental stageplant embryo bilateral stage
PO:0007095developmental stageLP.08 eight leaves visible stage
PO:0007098developmental stageLP.02 two leaves visible stage
PO:0007103developmental stageLP.10 ten leaves visible stage
PO:0007115developmental stageLP.04 four leaves visible stage
PO:0007123developmental stageLP.06 six leaves visible stage
PO:0007611developmental stagepetal differentiation and expansion stage
PO:0007616developmental stageflowering stage
Sequence ? help Back to Top
Protein Sequence    Length: 538 aa     Download sequence    Send to blast
MAVYYTSNVG CYQQEPIFLN HQQQNQQASS SSAAASFTVT GGDTVRNEMV FIPPTTTGDV  60
VTGNGTVSSS DLSFHDGQGL SLSLGTQISV APFHFHQYQL GFTSQNPSIS VKETSPFHVD  120
EMSVKSKEMI LLGQSDPSSG YAGNGGNGFY NNYRYNETSG GFMSSVLRSR YLKPAQNLLD  180
EVVSVKKELN QMGKKKMKVN DFNSGSKEIE GGGGELSSDS NGKSIELSTI EREELQNKKN  240
KLLTMVDEVD KRYNQYYHQM EALASSFEIV AGLGSAKPYT SVALNRISRH FRALRDAIKE  300
QIQIVREKLG EKGGESLDEQ QGERIPRLRY LDQRLRQQRA LHQQLGMVRP AWRPQRGLPE  360
NSVSVLRAWL FEHFLHPYPK ESEKIMLAKQ TGLSKNQVAN WFINARVRLW KPMIEEMYKE  420
EFGDESELLI SKSSQEPNST NQEDSSSQQQ QQQENNNNSN LAYSSADTTN IVFSSETKPD  480
RVLGNDNDPQ QQQINRSSDY DTLMNYHGFG VDDYRYISGS NQQESRFSNS HHLHDFVV
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3k2a_B4e-16358416563Homeobox protein Meis2
3k2a_A4e-16358416563Homeobox protein Meis2
Search in ModeBase
Expression -- Microarray ? help Back to Top
Source ID E-value
Genevisible261139_at0.0
Expression AtlasAT1G19700-
AtGenExpressAT1G19700-
ATTED-IIAT1G19700-
Functional Description ? help Back to Top
Source Description
TAIREncodes a member of the BEL family of homeodomain proteins. Its interaction with PLP (PAS/LOV PROTEIN) is diminished by blue light.
Cis-element ? help Back to Top
SourceLink
PlantRegMapAT1G19700.2
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Interaction ? help Back to Top
Source Intact With
BioGRIDAT1G23380, AT1G26260, AT1G75410
IntActSearch Q9FXG8
Phenotype -- Mutation ? help Back to Top
Source ID
T-DNA ExpressAT1G19700
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAY5705080.0AY570508.1 Arabidopsis thaliana BEL1-like homeodomain 5 protein mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_001154352.10.0BEL1-like homeodomain 10
RefseqNP_001185040.10.0BEL1-like homeodomain 10
RefseqNP_173400.10.0BEL1-like homeodomain 10
SwissprotQ9FXG80.0BLH10_ARATH; BEL1-like homeodomain protein 10
TrEMBLD7KI490.0D7KI49_ARALL; Putative uncharacterized protein
STRINGAT1G19700.10.0(Arabidopsis thaliana)
Publications ? help Back to Top
  1. Riechmann JL, et al.
    Arabidopsis transcription factors: genome-wide comparative analysis among eukaryotes.
    Science, 2000. 290(5499): p. 2105-10
    [PMID:11118137]
  2. Yamada K, et al.
    Empirical analysis of transcriptional activity in the Arabidopsis genome.
    Science, 2003. 302(5646): p. 842-6
    [PMID:14593172]
  3. Smith HM,Campbell BC,Hake S
    Competence to respond to floral inductive signals requires the homeobox genes PENNYWISE and POUND-FOOLISH.
    Curr. Biol., 2004. 14(9): p. 812-7
    [PMID:15120075]
  4. Hackbusch J,Richter K,Müller J,Salamini F,Uhrig JF
    A central role of Arabidopsis thaliana ovate family proteins in networking and subcellular localization of 3-aa loop extension homeodomain proteins.
    Proc. Natl. Acad. Sci. U.S.A., 2005. 102(13): p. 4908-12
    [PMID:15781858]
  5. Cork JM,Purugganan MD
    High-diversity genes in the Arabidopsis genome.
    Genetics, 2005. 170(4): p. 1897-911
    [PMID:15911589]
  6. Ogura Y, et al.
    Blue light diminishes interaction of PAS/LOV proteins, putative blue light receptors in Arabidopsis thaliana, with their interacting partners.
    J. Plant Res., 2008. 121(1): p. 97-105
    [PMID:17982713]
  7. Reininga JM,Nielsen D,Purugganan MD
    Functional and geographical differentiation of candidate balanced polymorphisms in Arabidopsis thaliana.
    Mol. Ecol., 2009. 18(13): p. 2844-55
    [PMID:19457201]
  8. Hanada K, et al.
    Functional compensation of primary and secondary metabolites by duplicate genes in Arabidopsis thaliana.
    Mol. Biol. Evol., 2011. 28(1): p. 377-82
    [PMID:20736450]
  9. Arabidopsis Interactome Mapping Consortium
    Evidence for network evolution in an Arabidopsis interactome map.
    Science, 2011. 333(6042): p. 601-7
    [PMID:21798944]