PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID AT1G19490.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis
Family bZIP
Protein Properties Length: 471aa    MW: 52632.6 Da    PI: 5.6807
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
AT1G19490.1genomeTAIRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_125.14e-08156218163
                  XXXXCHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
       bZIP_1   1 ekelkrerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleelkkevaklksev 63 
                  e+e +r rr   NRe+Ar   +R++a +eeL +k++ L+ eN+ L+ e +   ke ++l++ +
  AT1G19490.1 156 EREERRIRRILANRESARQTIRRRQAMCEELSKKAADLTYENENLRREKDWALKEFQSLETIN 218
                  78899*******************************************999999999988766 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003382.7E-9156220IPR004827Basic-leucine zipper domain
PfamPF001701.2E-7156218IPR004827Basic-leucine zipper domain
PROSITE profilePS502179.979158221IPR004827Basic-leucine zipper domain
SuperFamilySSF579592.72E-6160215No hitNo description
Gene3DG3DSA:1.20.5.1705.1E-7160226No hitNo description
CDDcd147021.22E-12166212No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 471 aa     Download sequence    Send to blast
MELEPISSSC CSSSSSSSGE ENTAAANMTE MEAAEALADL AQLAIMREQV FESAASWGSK  60
GKRVRKRVKT ESPPSDSLLK PPDSDTLPTP DLAEERLVKE EEEEEEVEPI TKELTKAPVK  120
SEINGETPKP ILASTLIRCS RSNGCGRSRQ NLSEAEREER RIRRILANRE SARQTIRRRQ  180
AMCEELSKKA ADLTYENENL RREKDWALKE FQSLETINKH LKEQVLKSVK PDTKEPEESP  240
KPSQVEMSTS STPFYFYNQN PYQLFCWPHV TQSSNPMISP LEFPTSGGAS AKTITTQEHE  300
NAADDNGQKT HFYVVPCPWF LPPPDHSNGV PFGLQDTQRG TFSNGHHIDD SSARPMDVTE  360
TPRSHLPTRI KEEDSGSPET RPLYDLNESA TEVLSEGGDG FPVTQQAYSL KHEDVSETTN  420
GVTLMPPGHH VLISLPEKKH GSLAAAEARK RRKELTRLKN LHGRQCRMQV G
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1448453RKRRKE
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
At.417440.0flower
Expression -- Microarray ? help Back to Top
Source ID
Expression AtlasAT1G19490
AtGenExpressAT1G19490
Cis-element ? help Back to Top
SourceLink
PlantRegMapAT1G19490.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Phenotype -- Mutation ? help Back to Top
Source ID
T-DNA ExpressAT1G19490
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankBT0003190.0BT000319.1 Arabidopsis thaliana unknown protein (At1g19490) mRNA, complete cds.
GenBankAY0998750.0AY099875.1 Arabidopsis thaliana unknown protein (At1g19490) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_173381.10.0basic-leucine zipper transcription factor family protein
TrEMBLQ8L5Y20.0Q8L5Y2_ARATH; BZIP transcription factor-like protein
STRINGAT1G19490.10.0(Arabidopsis thaliana)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM112112428
Representative plantOGRP45691318
Publications ? help Back to Top
  1. Riechmann JL, et al.
    Arabidopsis transcription factors: genome-wide comparative analysis among eukaryotes.
    Science, 2000. 290(5499): p. 2105-10
    [PMID:11118137]
  2. Jakoby M, et al.
    bZIP transcription factors in Arabidopsis.
    Trends Plant Sci., 2002. 7(3): p. 106-11
    [PMID:11906833]
  3. Dal Bosco C, et al.
    Inactivation of the chloroplast ATP synthase gamma subunit results in high non-photochemical fluorescence quenching and altered nuclear gene expression in Arabidopsis thaliana.
    J. Biol. Chem., 2004. 279(2): p. 1060-9
    [PMID:14576160]
  4. Deppmann CD, et al.
    Dimerization specificity of all 67 B-ZIP motifs in Arabidopsis thaliana: a comparison to Homo sapiens B-ZIP motifs.
    Nucleic Acids Res., 2004. 32(11): p. 3435-45
    [PMID:15226410]
  5. Deppmann CD,Alvania RS,Taparowsky EJ
    Cross-species annotation of basic leucine zipper factor interactions: Insight into the evolution of closed interaction networks.
    Mol. Biol. Evol., 2006. 23(8): p. 1480-92
    [PMID:16731568]
  6. Efroni I, et al.
    Regulation of leaf maturation by chromatin-mediated modulation of cytokinin responses.
    Dev. Cell, 2013. 24(4): p. 438-45
    [PMID:23449474]