PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID AT1G18790.1
Common NameAtRKD1, F6A14.11, RKD1, URP5
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis
Family Nin-like
Protein Properties Length: 269aa    MW: 30637.8 Da    PI: 9.0184
Description RWP-RK domain-containing protein
Gene Model
Gene Model ID Type Source Coding Sequence
AT1G18790.1genomeTAIRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1RWP-RK83.22.5e-26125175252
       RWP-RK   2 ekeisledlskyFslpikdAAkeLgvclTvLKriCRqyGIkRWPhRkiksl 52 
                  +k++s e++s yF++pi++AA+eL+++lT+LK++CR++GIkRWPhRk+ sl
  AT1G18790.1 125 SKTLSKETISLYFYMPITQAARELNIGLTLLKKRCRELGIKRWPHRKLMSL 175
                  5899********************************************997 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5151918.007106195IPR003035RWP-RK domain
PfamPF020426.0E-21127175IPR003035RWP-RK domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0051302Biological Processregulation of cell division
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 269 aa     Download sequence    Send to blast
MKSFCKLEYD QVFGKENNSF SFLNHSSLYS HQSELANPFF ELEDEMLPSA TSSNCFTSAS  60
SFLALPDLEP ISIVSHEADI LSVYGSASWT AEETMFVSDF AKKSETTTTK KRRCREECFS  120
SCSVSKTLSK ETISLYFYMP ITQAARELNI GLTLLKKRCR ELGIKRWPHR KLMSLQKLIS  180
NVKELEKMEG EENEDKLRNA LEKLEKEKKT IEKLPDLKFE DKTKRLRQAC FKANHKRKRR  240
SGMSTPITSS SSSASASSSS YSSVSGFER
Expression -- Microarray ? help Back to Top
Source ID E-value
GEO183946540.0
Expression AtlasAT1G18790-
AtGenExpressAT1G18790-
Functional Description ? help Back to Top
Source Description
UniProtPutative transcription factor. {ECO:0000250}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapAT1G18790.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Phenotype -- Mutation ? help Back to Top
Source ID
T-DNA ExpressAT1G18790
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC0118091e-179AC011809.2 Arabidopsis thaliana chromosome I BAC F6A14 genomic sequence, complete sequence.
GenBankCP0026841e-179CP002684.1 Arabidopsis thaliana chromosome 1 sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_173314.10.0RWP-RK domain-containing protein
SwissprotQ9M9U90.0RKD1_ARATH; Protein RKD1
TrEMBLA0A178WHM20.0A0A178WHM2_ARATH; URP5
STRINGAT1G18790.10.0(Arabidopsis thaliana)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM39662356
Representative plantOGRP5671777
Publications ? help Back to Top
  1. Riechmann JL, et al.
    Arabidopsis transcription factors: genome-wide comparative analysis among eukaryotes.
    Science, 2000. 290(5499): p. 2105-10
    [PMID:11118137]
  2. Schauser L,Wieloch W,Stougaard J
    Evolution of NIN-like proteins in Arabidopsis, rice, and Lotus japonicus.
    J. Mol. Evol., 2005. 60(2): p. 229-37
    [PMID:15785851]
  3. Koszegi D, et al.
    Members of the RKD transcription factor family induce an egg cell-like gene expression program.
    Plant J., 2011. 67(2): p. 280-91
    [PMID:21457369]
  4. Waki T, et al.
    A GAL4-based targeted activation tagging system in Arabidopsis thaliana.
    Plant J., 2013. 73(3): p. 357-67
    [PMID:23057675]