PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID AT1G18750.1
Common NameAGL65, F6A14.14
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis
Family M-type_MADS
Protein Properties Length: 389aa    MW: 44877.5 Da    PI: 6.5044
Description AGAMOUS-like 65
Gene Model
Gene Model ID Type Source Coding Sequence
AT1G18750.1genomeTAIRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF75.15.6e-24954146
                 S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEE CS
       SRF-TF  1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgkl 46
                 kr e++snrqvt++kR+ngilKKA+ELS+LCd+++ +++fs+tg+ 
  AT1G18750.1  9 KRLESTSNRQVTYTKRKNGILKKAKELSILCDIDIVLLMFSPTGRA 54
                 689*****************************************86 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5006625.735161IPR002100Transcription factor, MADS-box
SMARTSM004322.8E-31160IPR002100Transcription factor, MADS-box
SuperFamilySSF554551.57E-26295IPR002100Transcription factor, MADS-box
CDDcd002663.38E-27282No hitNo description
PRINTSPR004041.0E-19323IPR002100Transcription factor, MADS-box
PfamPF003193.4E-201157IPR002100Transcription factor, MADS-box
PRINTSPR004041.0E-192338IPR002100Transcription factor, MADS-box
PRINTSPR004041.0E-193859IPR002100Transcription factor, MADS-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0010152Biological Processpollen maturation
GO:0080092Biological Processregulation of pollen tube growth
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0005515Molecular Functionprotein binding
GO:0046983Molecular Functionprotein dimerization activity
Plant Ontology ? help Back to Top
PO Term PO Category PO Description
PO:0000013anatomycauline leaf
PO:0000037anatomyshoot apex
PO:0000230anatomyinflorescence meristem
PO:0000293anatomyguard cell
PO:0008019anatomyleaf lamina base
PO:0009006anatomyshoot system
PO:0009009anatomyplant embryo
PO:0009010anatomyseed
PO:0009025anatomyvascular leaf
PO:0009029anatomystamen
PO:0009030anatomycarpel
PO:0009031anatomysepal
PO:0009032anatomypetal
PO:0009046anatomyflower
PO:0009047anatomystem
PO:0009052anatomyflower pedicel
PO:0020030anatomycotyledon
PO:0020100anatomyhypocotyl
PO:0025022anatomycollective leaf structure
PO:0025195anatomypollen tube cell
PO:0025281anatomypollen
PO:0001016developmental stageL mature pollen stage
PO:0001017developmental stageM germinated pollen stage
PO:0001054developmental stagevascular leaf senescent stage
PO:0001078developmental stageplant embryo cotyledonary stage
PO:0001081developmental stagemature plant embryo stage
PO:0001185developmental stageplant embryo globular stage
PO:0004507developmental stageplant embryo bilateral stage
PO:0007064developmental stageLP.12 twelve leaves visible stage
PO:0007095developmental stageLP.08 eight leaves visible stage
PO:0007103developmental stageLP.10 ten leaves visible stage
PO:0007115developmental stageLP.04 four leaves visible stage
PO:0007123developmental stageLP.06 six leaves visible stage
PO:0007611developmental stagepetal differentiation and expansion stage
PO:0007616developmental stageflowering stage
Sequence ? help Back to Top
Protein Sequence    Length: 389 aa     Download sequence    Send to blast
MGRVKLKIKR LESTSNRQVT YTKRKNGILK KAKELSILCD IDIVLLMFSP TGRATAFHGE  60
HSCIEEVISK FAQLTPQERT KRKLESLEAL KKTFKKLDHD VNIHDFLGAR NQTIEGLSNQ  120
VAIYQAQLME CHRRLSCWTN IDRIENTEHL DLLEESLRKS IERIQIHKEH YRKNQLLPIE  180
CATTQFHSGI QLPMAMGGNS SMQEAHSMSW LPDNDHQQTI LPGDSSFLPH REMDGSIPVY  240
SSCFFESTKP EDQICSNPGQ QFEQLEQQGN GCLGLQQLGE EYSYPTPFGT TLGMEEDQEK  300
KIKSEMELNN LQQQQQQQQQ QQQQDPSMYD PMANNNGGCF QIPHDQSMFV NDHHHHHHHH  360
HQNWVPDSMF GQTSYNQVCV FTPPLELSR
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1tqe_P3e-14192190Myocyte-specific enhancer factor 2B
1tqe_Q3e-14192190Myocyte-specific enhancer factor 2B
1tqe_R3e-14192190Myocyte-specific enhancer factor 2B
1tqe_S3e-14192190Myocyte-specific enhancer factor 2B
6c9l_A3e-14192190Myocyte-specific enhancer factor 2B
6c9l_B3e-14192190Myocyte-specific enhancer factor 2B
6c9l_C3e-14192190Myocyte-specific enhancer factor 2B
6c9l_D3e-14192190Myocyte-specific enhancer factor 2B
6c9l_E3e-14192190Myocyte-specific enhancer factor 2B
6c9l_F3e-14192190Myocyte-specific enhancer factor 2B
Search in ModeBase
Expression -- Microarray ? help Back to Top
Source ID E-value
Genevisible261423_at0.0
Expression AtlasAT1G18750-
AtGenExpressAT1G18750-
ATTED-IIAT1G18750-
Expression -- Description ? help Back to Top
Source Description
UniprotTISSUE SPECIFICITY: Expressed in pollen. {ECO:0000269|PubMed:12949148}.
Functional Description ? help Back to Top
Source Description
TAIREncodes a member of the MIKC (MADS box, Keratin binding domain, and C terminal domain containing )family of transcriptional regulators. AGL65 is expressed in pollen.It forms heterodimers with other MICK family members (AGL104). Involved in late stages of pollen development and pollen tube growth.
UniProtProbable transcription factor that forms a heterodimer with the MADS-box protein AGL104 and is involved in the regulation of pollen maturation at the late stages of pollen development and pollen tube growth. {ECO:0000269|PubMed:19211705}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapAT1G18750.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Interaction ? help Back to Top
Source Intact With
BioGRIDAT1G22130, AT1G31630, AT1G46408, AT1G48150, AT1G77980
IntActSearch Q7X9I0
Phenotype -- Mutation ? help Back to Top
Source ID
T-DNA ExpressAT1G18750
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAY1431720.0AY143172.1 Arabidopsis thaliana MADS-box protein AGL65 (AGL65) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_173310.20.0AGAMOUS-like 65
SwissprotQ7X9I00.0AGL65_ARATH; Agamous-like MADS-box protein AGL65
TrEMBLD7KH660.0D7KH66_ARALL; AGL102
STRINGAT1G18750.10.0(Arabidopsis thaliana)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM59332543
Representative plantOGRP59461119
Publications ? help Back to Top
  1. Riechmann JL, et al.
    Arabidopsis transcription factors: genome-wide comparative analysis among eukaryotes.
    Science, 2000. 290(5499): p. 2105-10
    [PMID:11118137]
  2. De Bodt S, et al.
    Genomewide structural annotation and evolutionary analysis of the type I MADS-box genes in plants.
    J. Mol. Evol., 2003. 56(5): p. 573-86
    [PMID:12698294]
  3. Parenicov√° L, et al.
    Molecular and phylogenetic analyses of the complete MADS-box transcription factor family in Arabidopsis: new openings to the MADS world.
    Plant Cell, 2003. 15(7): p. 1538-51
    [PMID:12837945]
  4. Kofuji R, et al.
    Evolution and divergence of the MADS-box gene family based on genome-wide expression analyses.
    Mol. Biol. Evol., 2003. 20(12): p. 1963-77
    [PMID:12949148]
  5. de Folter S, et al.
    Comprehensive interaction map of the Arabidopsis MADS Box transcription factors.
    Plant Cell, 2005. 17(5): p. 1424-33
    [PMID:15805477]
  6. Pina C,Pinto F,Feij
    Gene family analysis of the Arabidopsis pollen transcriptome reveals biological implications for cell growth, division control, and gene expression regulation.
    Plant Physiol., 2005. 138(2): p. 744-56
    [PMID:15908605]
  7. Verelst W,Saedler H,M√ľnster T
    MIKC* MADS-protein complexes bind motifs enriched in the proximal region of late pollen-specific Arabidopsis promoters.
    Plant Physiol., 2007. 143(1): p. 447-60
    [PMID:17071640]
  8. Wang Y, et al.
    Transcriptome analyses show changes in gene expression to accompany pollen germination and tube growth in Arabidopsis.
    Plant Physiol., 2008. 148(3): p. 1201-11
    [PMID:18775970]
  9. Adamczyk BJ,Fernandez DE
    MIKC* MADS domain heterodimers are required for pollen maturation and tube growth in Arabidopsis.
    Plant Physiol., 2009. 149(4): p. 1713-23
    [PMID:19211705]
  10. Zhang S, et al.
    FERTILIZATION-INDEPENDENT SEED-Polycomb Repressive Complex 2 Plays a Dual Role in Regulating Type I MADS-Box Genes in Early Endosperm Development.
    Plant Physiol., 2018. 177(1): p. 285-299
    [PMID:29523711]