PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID AT1G18570.1
Common NameAtMYB51, BW51A, BW51B, F25I16.9, HIG1, MYB51
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis
Family MYB
Protein Properties Length: 352aa    MW: 39154.4 Da    PI: 5.6488
Description myb domain protein 51
Gene Model
Gene Model ID Type Source Coding Sequence
AT1G18570.1genomeTAIRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding53.94.1e-171562148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     +g+WT+eEd++l+ + +++G g W+t +++ g++R++k+c++rw +yl
      AT1G18570.1 15 KGAWTPEEDQKLLSYLNRHGEGGWRTLPEKAGLKRCGKSCRLRWANYL 62
                     79********************************************97 PP

2Myb_DNA-binding52.61e-1668112147
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                      rg +T++E+  ++ +++++G++ W++Iar ++ gRt++++k++w+++
      AT1G18570.1  68 RGEFTEDEERSIISLHALHGNK-WSAIARGLP-GRTDNEIKNYWNTH 112
                      899*******************.*********.************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129414.7861062IPR017930Myb domain
SuperFamilySSF466895.99E-2912109IPR009057Homeodomain-like
SMARTSM007177.6E-131464IPR001005SANT/Myb domain
PfamPF002491.3E-151562IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.602.5E-231669IPR009057Homeodomain-like
CDDcd001678.62E-101762No hitNo description
PROSITE profilePS5129425.38163117IPR017930Myb domain
SMARTSM007173.4E-1667115IPR001005SANT/Myb domain
PfamPF002492.2E-1568112IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.606.2E-2670118IPR009057Homeodomain-like
CDDcd001673.94E-1270113No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006357Biological Processregulation of transcription from RNA polymerase II promoter
GO:0009625Biological Processresponse to insect
GO:0009651Biological Processresponse to salt stress
GO:0009682Biological Processinduced systemic resistance
GO:0009723Biological Processresponse to ethylene
GO:0009733Biological Processresponse to auxin
GO:0009737Biological Processresponse to abscisic acid
GO:0009739Biological Processresponse to gibberellin
GO:0009751Biological Processresponse to salicylic acid
GO:0009753Biological Processresponse to jasmonic acid
GO:0009759Biological Processindole glucosinolate biosynthetic process
GO:0030154Biological Processcell differentiation
GO:0052544Biological Processdefense response by callose deposition in cell wall
GO:0005634Cellular Componentnucleus
GO:0000981Molecular FunctionRNA polymerase II transcription factor activity, sequence-specific DNA binding
GO:0001135Molecular Functiontranscription factor activity, RNA polymerase II transcription factor recruiting
GO:0043565Molecular Functionsequence-specific DNA binding
GO:0044212Molecular Functiontranscription regulatory region DNA binding
Plant Ontology ? help Back to Top
PO Term PO Category PO Description
PO:0000013anatomycauline leaf
PO:0000037anatomyshoot apex
PO:0000230anatomyinflorescence meristem
PO:0000293anatomyguard cell
PO:0009005anatomyroot
PO:0009015anatomyportion of vascular tissue
PO:0009025anatomyvascular leaf
PO:0009029anatomystamen
PO:0009031anatomysepal
PO:0009046anatomyflower
PO:0009047anatomystem
PO:0009062anatomygynoecium
PO:0020030anatomycotyledon
PO:0020038anatomypetiole
PO:0020100anatomyhypocotyl
PO:0020137anatomyleaf apex
PO:0025022anatomycollective leaf structure
PO:0001054developmental stagevascular leaf senescent stage
PO:0007064developmental stageLP.12 twelve leaves visible stage
PO:0007095developmental stageLP.08 eight leaves visible stage
PO:0007098developmental stageLP.02 two leaves visible stage
PO:0007103developmental stageLP.10 ten leaves visible stage
PO:0007115developmental stageLP.04 four leaves visible stage
PO:0007123developmental stageLP.06 six leaves visible stage
PO:0007611developmental stagepetal differentiation and expansion stage
PO:0007616developmental stageflowering stage
Sequence ? help Back to Top
Protein Sequence    Length: 352 aa     Download sequence    Send to blast
MVRTPCCKAE LGLKKGAWTP EEDQKLLSYL NRHGEGGWRT LPEKAGLKRC GKSCRLRWAN  60
YLRPDIKRGE FTEDEERSII SLHALHGNKW SAIARGLPGR TDNEIKNYWN THIKKRLIKK  120
GIDPVTHKGI TSGTDKSENL PEKQNVNLTT SDHDLDNDKA KKNNKNFGLS SASFLNKVAN  180
RFGKRINQSV LSEIIGSGGP LASTSHTTNT TTTSVSVDSE SVKSTSSSFA PTSNLLCHGT  240
VATTPVSSNF DVDGNVNLTC SSSTFSDSSV NNPLMYCDNF VGNNNVDDED TIGFSTFLND  300
EDFMMLEESC VENTAFMKEL TRFLHEDEND VVDVTPVYER QDLFDEIDNY FG
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A2e-28131175108B-MYB
Search in ModeBase
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
At.109080.0root| seed| vegetative tissue
Expression -- Microarray ? help Back to Top
Source ID E-value
GEO425621500.0
Genevisible255753_at0.0
Expression AtlasAT1G18570-
AtGenExpressAT1G18570-
ATTED-IIAT1G18570-
Expression -- Description ? help Back to Top
Source Description
UniprotTISSUE SPECIFICITY: Expressed in vegetative parts of the plant, mainly in mature rosette leaves and in trichomes. Detected in roots, but not in mature flowers or siliques. {ECO:0000269|PubMed:17461791, ECO:0000269|PubMed:23115560}.
Functional Description ? help Back to Top
Source Description
TAIREncodes a member of the R2R3-MYB transcription family. Involved in indole glucosinolate biosynthesis.
UniProtTranscription factor positively regulating indolic glucosinolate biosynthetic pathway genes. {ECO:0000269|PubMed:17461791, ECO:0000269|PubMed:23580754, ECO:0000269|PubMed:23943862}.
Function -- GeneRIF ? help Back to Top
  1. MYB51 is a regulator of indolic glucosinolate biosynthesis that also controls responses to biotic challenges.
    [PMID: 17461791]
  2. interacts with basic helix-loop-helix transcription factor 05
    [PMID: 25049362]
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00147DAP27203113Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMapAT1G18570.1
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: Up-regulated by touch or wounding. {ECO:0000269|PubMed:17461791, ECO:0000269|PubMed:23115560}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Regulation -- ATRM (Manually Curated Upstream Regulators) ? help Back to Top
Source Upstream Regulator (A: Activate/R: Repress)
ATRM AT1G32640 (R)
Regulation -- ATRM (Manually Curated Target Genes) ? help Back to Top
Source Target Gene (A: Activate/R: Repress)
ATRM AT1G74100(A), AT2G22330(A), AT4G31500(A), AT4G39950(A), AT4G39980(A), AT5G54810(A)
Regulation -- Hormone ? help Back to Top
Source Hormone
AHDabscisic acid, auxin, ethylene, gibberellin, jasmonic acid, salicylic acid
Interaction ? help Back to Top
Source Intact With
BioGRIDAT1G32640, AT1G52150
Phenotype -- Disruption Phenotype ? help Back to Top
Source Description
UniProtDISRUPTION PHENOTYPE: Low levels of indolic glucosinolates. {ECO:0000269|PubMed:17461791, ECO:0000269|PubMed:23580754}.
Phenotype -- Mutation ? help Back to Top
Source ID
T-DNA ExpressAT1G18570
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK1173310.0AK117331.1 Arabidopsis thaliana At1g18570 mRNA for unknown protein, complete cds, clone: RAFL16-90-B03.
GenBankAY5195550.0AY519555.1 Arabidopsis thaliana MYB transcription factor (At1g18570) mRNA, complete cds.
GenBankBT0062440.0BT006244.1 Arabidopsis thaliana At1g18570 mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_173292.10.0myb domain protein 51
SwissprotO497820.0MYB51_ARATH; Transcription factor MYB51
TrEMBLA0A178WB710.0A0A178WB71_ARATH; MYB51
STRINGAT1G18570.10.0(Arabidopsis thaliana)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM4282646
Representative plantOGRP5171784
Publications ? help Back to Top
  1. Riechmann JL, et al.
    Arabidopsis transcription factors: genome-wide comparative analysis among eukaryotes.
    Science, 2000. 290(5499): p. 2105-10
    [PMID:11118137]
  2. Stracke R,Werber M,Weisshaar B
    The R2R3-MYB gene family in Arabidopsis thaliana.
    Curr. Opin. Plant Biol., 2001. 4(5): p. 447-56
    [PMID:11597504]
  3. Seki M, et al.
    Functional annotation of a full-length Arabidopsis cDNA collection.
    Science, 2002. 296(5565): p. 141-5
    [PMID:11910074]
  4. Yamada K, et al.
    Empirical analysis of transcriptional activity in the Arabidopsis genome.
    Science, 2003. 302(5646): p. 842-6
    [PMID:14593172]
  5. Barth C,Moeder W,Klessig DF,Conklin PL
    The timing of senescence and response to pathogens is altered in the ascorbate-deficient Arabidopsis mutant vitamin c-1.
    Plant Physiol., 2004. 134(4): p. 1784-92
    [PMID:15064386]
  6. S
    ABA activates ADPR cyclase and cADPR induces a subset of ABA-responsive genes in Arabidopsis.
    Plant J., 2004. 38(3): p. 381-95
    [PMID:15086800]
  7. Ko JH,Han KH,Park S,Yang J
    Plant body weight-induced secondary growth in Arabidopsis and its transcription phenotype revealed by whole-transcriptome profiling.
    Plant Physiol., 2004. 135(2): p. 1069-83
    [PMID:15194820]
  8. Guan Y,Nothnagel EA
    Binding of arabinogalactan proteins by Yariv phenylglycoside triggers wound-like responses in Arabidopsis cell cultures.
    Plant Physiol., 2004. 135(3): p. 1346-66
    [PMID:15235117]
  9. Stanley Kim H, et al.
    Transcriptional divergence of the duplicated oxidative stress-responsive genes in the Arabidopsis genome.
    Plant J., 2005. 41(2): p. 212-20
    [PMID:15634198]
  10. Schneider A, et al.
    A transposon-based activation-tagging population in Arabidopsis thaliana (TAMARA) and its application in the identification of dominant developmental and metabolic mutations.
    FEBS Lett., 2005. 579(21): p. 4622-8
    [PMID:16087178]
  11. Duarte JM, et al.
    Expression pattern shifts following duplication indicative of subfunctionalization and neofunctionalization in regulatory genes of Arabidopsis.
    Mol. Biol. Evol., 2006. 23(2): p. 469-78
    [PMID:16280546]
  12. Yanhui C, et al.
    The MYB transcription factor superfamily of Arabidopsis: expression analysis and phylogenetic comparison with the rice MYB family.
    Plant Mol. Biol., 2006. 60(1): p. 107-24
    [PMID:16463103]
  13. Thilmony R,Underwood W,He SY
    Genome-wide transcriptional analysis of the Arabidopsis thaliana interaction with the plant pathogen Pseudomonas syringae pv. tomato DC3000 and the human pathogen Escherichia coli O157:H7.
    Plant J., 2006. 46(1): p. 34-53
    [PMID:16553894]
  14. AbuQamar S, et al.
    Expression profiling and mutant analysis reveals complex regulatory networks involved in Arabidopsis response to Botrytis infection.
    Plant J., 2006. 48(1): p. 28-44
    [PMID:16925600]
  15. Xin Z,Mandaokar A,Chen J,Last RL,Browse J
    Arabidopsis ESK1 encodes a novel regulator of freezing tolerance.
    Plant J., 2007. 49(5): p. 786-99
    [PMID:17316173]
  16. Lee J, et al.
    Analysis of transcription factor HY5 genomic binding sites revealed its hierarchical role in light regulation of development.
    Plant Cell, 2007. 19(3): p. 731-49
    [PMID:17337630]
  17. Gigolashvili T, et al.
    The transcription factor HIG1/MYB51 regulates indolic glucosinolate biosynthesis in Arabidopsis thaliana.
    Plant J., 2007. 50(5): p. 886-901
    [PMID:17461791]
  18. Dombrecht B, et al.
    MYC2 differentially modulates diverse jasmonate-dependent functions in Arabidopsis.
    Plant Cell, 2007. 19(7): p. 2225-45
    [PMID:17616737]
  19. Ascencio-Ib
    Global analysis of Arabidopsis gene expression uncovers a complex array of changes impacting pathogen response and cell cycle during geminivirus infection.
    Plant Physiol., 2008. 148(1): p. 436-54
    [PMID:18650403]
  20. Malitsky S, et al.
    The transcript and metabolite networks affected by the two clades of Arabidopsis glucosinolate biosynthesis regulators.
    Plant Physiol., 2008. 148(4): p. 2021-49
    [PMID:18829985]
  21. Clay NK,Adio AM,Denoux C,Jander G,Ausubel FM
    Glucosinolate metabolites required for an Arabidopsis innate immune response.
    Science, 2009. 323(5910): p. 95-101
    [PMID:19095898]
  22. Millet YA, et al.
    Innate immune responses activated in Arabidopsis roots by microbe-associated molecular patterns.
    Plant Cell, 2010. 22(3): p. 973-90
    [PMID:20348432]
  23. O'Brien JA, et al.
    A peroxidase-dependent apoplastic oxidative burst in cultured Arabidopsis cells functions in MAMP-elicited defense.
    Plant Physiol., 2012. 158(4): p. 2013-27
    [PMID:22319074]
  24. Maekawa S, et al.
    The Arabidopsis ubiquitin ligases ATL31 and ATL6 control the defense response as well as the carbon/nitrogen response.
    Plant Mol. Biol., 2012. 79(3): p. 217-27
    [PMID:22481162]
  25. Meinke DW
    A survey of dominant mutations in Arabidopsis thaliana.
    Trends Plant Sci., 2013. 18(2): p. 84-91
    [PMID:22995285]
  26. Laluk K, et al.
    The calmodulin-binding transcription factor SIGNAL RESPONSIVE1 is a novel regulator of glucosinolate metabolism and herbivory tolerance in Arabidopsis.
    Plant Cell Physiol., 2012. 53(12): p. 2008-15
    [PMID:23072934]
  27. van de Mortel JE, et al.
    Metabolic and transcriptomic changes induced in Arabidopsis by the rhizobacterium Pseudomonas fluorescens SS101.
    Plant Physiol., 2012. 160(4): p. 2173-88
    [PMID:23073694]
  28. Frerigmann H,B
    Glucosinolates are produced in trichomes of Arabidopsis thaliana.
    Front Plant Sci, 2012. 3: p. 242
    [PMID:23115560]
  29. Mewis I,Khan MA,Glawischnig E,Schreiner M,Ulrichs C
    Water stress and aphid feeding differentially influence metabolite composition in Arabidopsis thaliana (L.).
    PLoS ONE, 2012. 7(11): p. e48661
    [PMID:23144921]
  30. Dubois M, et al.
    Ethylene Response Factor6 acts as a central regulator of leaf growth under water-limiting conditions in Arabidopsis.
    Plant Physiol., 2013. 162(1): p. 319-32
    [PMID:23553636]
  31. Guo R, et al.
    BZR1 and BES1 participate in regulation of glucosinolate biosynthesis by brassinosteroids in Arabidopsis.
    J. Exp. Bot., 2013. 64(8): p. 2401-12
    [PMID:23580754]
  32. Schweizer F, et al.
    Arabidopsis basic helix-loop-helix transcription factors MYC2, MYC3, and MYC4 regulate glucosinolate biosynthesis, insect performance, and feeding behavior.
    Plant Cell, 2013. 25(8): p. 3117-32
    [PMID:23943862]
  33. Benstein RM, et al.
    Arabidopsis phosphoglycerate dehydrogenase1 of the phosphoserine pathway is essential for development and required for ammonium assimilation and tryptophan biosynthesis.
    Plant Cell, 2013. 25(12): p. 5011-29
    [PMID:24368794]
  34. Ding Y, et al.
    Four distinct types of dehydration stress memory genes in Arabidopsis thaliana.
    BMC Plant Biol., 2013. 13: p. 229
    [PMID:24377444]
  35. Frerigmann H,Gigolashvili T
    MYB34, MYB51, and MYB122 distinctly regulate indolic glucosinolate biosynthesis in Arabidopsis thaliana.
    Mol Plant, 2014. 7(5): p. 814-28
    [PMID:24431192]
  36. Frerigmann H,Berger B,Gigolashvili T
    bHLH05 is an interaction partner of MYB51 and a novel regulator of glucosinolate biosynthesis in Arabidopsis.
    Plant Physiol., 2014. 166(1): p. 349-69
    [PMID:25049362]
  37. Frerigmann H,Gigolashvili T
    Update on the role of R2R3-MYBs in the regulation of glucosinolates upon sulfur deficiency.
    Front Plant Sci, 2014. 5: p. 626
    [PMID:25426131]
  38. Jin J, et al.
    An Arabidopsis Transcriptional Regulatory Map Reveals Distinct Functional and Evolutionary Features of Novel Transcription Factors.
    Mol. Biol. Evol., 2015. 32(7): p. 1767-73
    [PMID:25750178]
  39. Peskan-Berghöfer T, et al.
    Sustained exposure to abscisic acid enhances the colonization potential of the mutualist fungus Piriformospora indica on Arabidopsis thaliana roots.
    New Phytol., 2015. 208(3): p. 873-86
    [PMID:26075497]
  40. Frerigmann H,Glawischnig E,Gigolashvili T
    The role of MYB34, MYB51 and MYB122 in the regulation of camalexin biosynthesis in Arabidopsis thaliana.
    Front Plant Sci, 2015. 6: p. 654
    [PMID:26379682]
  41. Frerigmann H, et al.
    Regulation of Pathogen-Triggered Tryptophan Metabolism in Arabidopsis thaliana by MYB Transcription Factors and Indole Glucosinolate Conversion Products.
    Mol Plant, 2016. 9(5): p. 682-695
    [PMID:26802248]
  42. Bulgakov VP,Veremeichik GN,Grigorchuk VP,Rybin VG,Shkryl YN
    The rolB gene activates secondary metabolism in Arabidopsis calli via selective activation of genes encoding MYB and bHLH transcription factors.
    Plant Physiol. Biochem., 2016. 102: p. 70-9
    [PMID:26913794]
  43. Xu J, et al.
    Pathogen-Responsive MPK3 and MPK6 Reprogram the Biosynthesis of Indole Glucosinolates and Their Derivatives in Arabidopsis Immunity.
    Plant Cell, 2016. 28(5): p. 1144-62
    [PMID:27081184]
  44. Miao H, et al.
    Glucose enhances indolic glucosinolate biosynthesis without reducing primary sulfur assimilation.
    Sci Rep, 2016. 6: p. 31854
    [PMID:27549907]
  45. Romero I, et al.
    More than 80R2R3-MYB regulatory genes in the genome of Arabidopsis thaliana.
    Plant J., 1998. 14(3): p. 273-84
    [PMID:9628022]
  46. Kranz HD, et al.
    Towards functional characterisation of the members of the R2R3-MYB gene family from Arabidopsis thaliana.
    Plant J., 1998. 16(2): p. 263-76
    [PMID:9839469]