PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID AT1G18330.1
Common NameEPR1, F15H18.16, RVE7
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis
Family MYB_related
Protein Properties Length: 346aa    MW: 38350.7 Da    PI: 7.9978
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
AT1G18330.1genomeTAIRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding54.72.3e-175094147
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47
                     r +W++eE++++++a+k++G g W+ I +++g ++t+ q++s+ qk+
      AT1G18330.1 50 REKWSEEEHDRFLEAIKLYGRG-WRQIQEHIG-TKTAVQIRSHAQKF 94
                     789*******************.*********.************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466896.65E-164498IPR009057Homeodomain-like
PROSITE profilePS5129419.7684599IPR017930Myb domain
Gene3DG3DSA:1.10.10.609.4E-104697IPR009057Homeodomain-like
TIGRFAMsTIGR015576.7E-164897IPR006447Myb domain, plants
SMARTSM007175.2E-134997IPR001005SANT/Myb domain
PfamPF002495.8E-155093IPR001005SANT/Myb domain
CDDcd001674.64E-115295No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0007623Biological Processcircadian rhythm
GO:0009651Biological Processresponse to salt stress
GO:0009723Biological Processresponse to ethylene
GO:0046686Biological Processresponse to cadmium ion
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
Plant Ontology ? help Back to Top
PO Term PO Category PO Description
PO:0000013anatomycauline leaf
PO:0000037anatomyshoot apex
PO:0000230anatomyinflorescence meristem
PO:0000293anatomyguard cell
PO:0008019anatomyleaf lamina base
PO:0009005anatomyroot
PO:0009006anatomyshoot system
PO:0009009anatomyplant embryo
PO:0009010anatomyseed
PO:0009025anatomyvascular leaf
PO:0009029anatomystamen
PO:0009030anatomycarpel
PO:0009031anatomysepal
PO:0009032anatomypetal
PO:0009046anatomyflower
PO:0009047anatomystem
PO:0009052anatomyflower pedicel
PO:0020030anatomycotyledon
PO:0020038anatomypetiole
PO:0020100anatomyhypocotyl
PO:0020137anatomyleaf apex
PO:0025022anatomycollective leaf structure
PO:0025281anatomypollen
PO:0001054developmental stagevascular leaf senescent stage
PO:0001078developmental stageplant embryo cotyledonary stage
PO:0001081developmental stagemature plant embryo stage
PO:0001185developmental stageplant embryo globular stage
PO:0004507developmental stageplant embryo bilateral stage
PO:0007064developmental stageLP.12 twelve leaves visible stage
PO:0007095developmental stageLP.08 eight leaves visible stage
PO:0007098developmental stageLP.02 two leaves visible stage
PO:0007103developmental stageLP.10 ten leaves visible stage
PO:0007115developmental stageLP.04 four leaves visible stage
PO:0007123developmental stageLP.06 six leaves visible stage
PO:0007611developmental stagepetal differentiation and expansion stage
PO:0007616developmental stageflowering stage
Sequence ? help Back to Top
Protein Sequence    Length: 346 aa     Download sequence    Send to blast
MAAEDRSEEL SSNVENGSCN SNEGINPETS SHWIENVVKV RKPYTVTKQR EKWSEEEHDR  60
FLEAIKLYGR GWRQIQEHIG TKTAVQIRSH AQKFFSKMAQ EADSRSEGSV KAIVIPPPRP  120
KRKPAHPYPR KSPVPYTQSP PPNLSAMEKG TKSPTSVLSS FGSEDQVNRC SSPNSCTSDI  180
QSIGATSIDK KNNYTTSKQP FKDDSDIGST PISSITLFGK IVLVAEESHK PSSYNDDDLK  240
QMTCQENHYS GMLVDTNLSL GVWETFCTGS NAFGSVTEAS ENLEKSAEPI SSSWKRLSSL  300
EKQGSCNPVN ASGFRPYKRC LSEREVTSSL TLVASDEKKS QRARIC
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
At.271310.0flower| silique| vegetative tissue
Expression -- Microarray ? help Back to Top
Source ID E-value
Genevisible261663_at0.0
Expression AtlasAT1G18330-
AtGenExpressAT1G18330-
ATTED-IIAT1G18330-
Functional Description ? help Back to Top
Source Description
TAIREARLY-PHYTOCHROME-RESPONSIVE1
UniProtTranscription factor involved in phytochrome A-mediated cotyledon opening. Controlled by the central oscillator mediated by LHY and CCA1. Part of a regulatory circadian feedback loop. Regulates its own expression. {ECO:0000269|PubMed:14523250}.
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00146DAP27203113Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMapAT1G18330.1
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: Circadian-regulation. Peak of transcript abundance near subjective dawn. Up-regulated transiently by red light and far red light. {ECO:0000269|PubMed:14523250, ECO:0000269|PubMed:19805390}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Regulation -- ATRM (Manually Curated Upstream Regulators) ? help Back to Top
Source Upstream Regulator (A: Activate/R: Repress)
ATRM AT5G10140 (R)
Regulation -- Hormone ? help Back to Top
Source Hormone
AHDethylene
Phenotype -- Disruption Phenotype ? help Back to Top
Source Description
UniProtDISRUPTION PHENOTYPE: No effect on the regulation of core clock associated genes or on the hypocotyl length. Rve1, rve2 and rve7 triple mutant has no alteration in the period or phase of the clock. {ECO:0000269|PubMed:19805390}.
Phenotype -- Mutation ? help Back to Top
Source ID
T-DNA ExpressAT1G18330
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAB1156960.0AB115696.1 Arabidopsis thaliana EPR1 mRNA for MYB-related transcription factor EPR1, complete cds.
GenBankAY0639520.0AY063952.1 Arabidopsis thaliana unknown protein (At1g18330) mRNA, complete cds.
GenBankAY1140700.0AY114070.1 Arabidopsis thaliana unknown protein (At1g18330) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_001117304.10.0Homeodomain-like superfamily protein
RefseqNP_173269.10.0Homeodomain-like superfamily protein
SwissprotB3H5A80.0RVE7_ARATH; Protein REVEILLE 7
TrEMBLD7KGC90.0D7KGC9_ARALL; Early-phytochrome-responsive1
STRINGAT1G18330.20.0(Arabidopsis thaliana)
Publications ? help Back to Top
  1. Riechmann JL, et al.
    Arabidopsis transcription factors: genome-wide comparative analysis among eukaryotes.
    Science, 2000. 290(5499): p. 2105-10
    [PMID:11118137]
  2. Kuno N, et al.
    The novel MYB protein EARLY-PHYTOCHROME-RESPONSIVE1 is a component of a slave circadian oscillator in Arabidopsis.
    Plant Cell, 2003. 15(10): p. 2476-88
    [PMID:14523250]
  3. Yamada K, et al.
    Empirical analysis of transcriptional activity in the Arabidopsis genome.
    Science, 2003. 302(5646): p. 842-6
    [PMID:14593172]
  4. Schneider A, et al.
    A transposon-based activation-tagging population in Arabidopsis thaliana (TAMARA) and its application in the identification of dominant developmental and metabolic mutations.
    FEBS Lett., 2005. 579(21): p. 4622-8
    [PMID:16087178]
  5. Yanhui C, et al.
    The MYB transcription factor superfamily of Arabidopsis: expression analysis and phylogenetic comparison with the rice MYB family.
    Plant Mol. Biol., 2006. 60(1): p. 107-24
    [PMID:16463103]
  6. Edwards KD, et al.
    FLOWERING LOCUS C mediates natural variation in the high-temperature response of the Arabidopsis circadian clock.
    Plant Cell, 2006. 18(3): p. 639-50
    [PMID:16473970]
  7. Khanna R, et al.
    Functional profiling reveals that only a small number of phytochrome-regulated early-response genes in Arabidopsis are necessary for optimal deetiolation.
    Plant Cell, 2006. 18(9): p. 2157-71
    [PMID:16891401]
  8. Zhang X, et al.
    Constitutive expression of CIR1 (RVE2) affects several circadian-regulated processes and seed germination in Arabidopsis.
    Plant J., 2007. 51(3): p. 512-25
    [PMID:17587236]
  9. Rawat R, et al.
    REVEILLE1, a Myb-like transcription factor, integrates the circadian clock and auxin pathways.
    Proc. Natl. Acad. Sci. U.S.A., 2009. 106(39): p. 16883-8
    [PMID:19805390]
  10. Li G, et al.
    Coordinated transcriptional regulation underlying the circadian clock in Arabidopsis.
    Nat. Cell Biol., 2011. 13(5): p. 616-22
    [PMID:21499259]
  11. Causier B,Ashworth M,Guo W,Davies B
    The TOPLESS interactome: a framework for gene repression in Arabidopsis.
    Plant Physiol., 2012. 158(1): p. 423-38
    [PMID:22065421]
  12. Owens SM,Harberson NA,Moore RC
    Asymmetric functional divergence of young, dispersed gene duplicates in Arabidopsis thaliana.
    J. Mol. Evol., 2013. 76(1-2): p. 13-27
    [PMID:23344714]
  13. Kim DY,Scalf M,Smith LM,Vierstra RD
    Advanced proteomic analyses yield a deep catalog of ubiquitylation targets in Arabidopsis.
    Plant Cell, 2013. 25(5): p. 1523-40
    [PMID:23667124]
  14. Ding Y, et al.
    Four distinct types of dehydration stress memory genes in Arabidopsis thaliana.
    BMC Plant Biol., 2013. 13: p. 229
    [PMID:24377444]
  15. Jin J, et al.
    An Arabidopsis Transcriptional Regulatory Map Reveals Distinct Functional and Evolutionary Features of Novel Transcription Factors.
    Mol. Biol. Evol., 2015. 32(7): p. 1767-73
    [PMID:25750178]