PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID AT1G17590.4
Common NameF11A6.14, F1L3.29, NFYA8, NF-YA8
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis
Family NF-YA
Protein Properties Length: 328aa    MW: 36462.7 Da    PI: 9.5762
Description nuclear factor Y, subunit A8
Gene Model
Gene Model ID Type Source Coding Sequence
AT1G17590.4genomeTAIRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1CBFB_NFYA102.83.2e-32171227158
    CBFB_NFYA   1 deplYVNaKQyqrIlkRRqkRakleeekkldeksrkpylheSRhkhAlrRpRgsgGrF 58 
                  +ep++VNaKQ+++I++RRq+Rakle+++kl +k+rkpylheSRh hAl+RpRgsgGrF
  AT1G17590.4 171 NEPVFVNAKQFHAIMRRRQQRAKLEAQNKL-IKARKPYLHESRHVHALKRPRGSGGRF 227
                  59****************************.**************************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM005212.2E-37169230IPR001289Nuclear transcription factor Y subunit A
PROSITE profilePS5115237.14170230IPR001289Nuclear transcription factor Y subunit A
PfamPF020456.0E-27172227IPR001289Nuclear transcription factor Y subunit A
PRINTSPR006163.1E-23173195IPR001289Nuclear transcription factor Y subunit A
PROSITE patternPS006860175195IPR018362CCAAT-binding factor, conserved site
PRINTSPR006163.1E-23204227IPR001289Nuclear transcription factor Y subunit A
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0016602Cellular ComponentCCAAT-binding factor complex
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
Plant Ontology ? help Back to Top
PO Term PO Category PO Description
PO:0000191anatomysynergid
PO:0000230anatomyinflorescence meristem
PO:0000293anatomyguard cell
PO:0009005anatomyroot
PO:0009009anatomyplant embryo
PO:0009010anatomyseed
PO:0009046anatomyflower
PO:0009047anatomystem
PO:0020100anatomyhypocotyl
PO:0001078developmental stageplant embryo cotyledonary stage
PO:0004507developmental stageplant embryo bilateral stage
PO:0007611developmental stagepetal differentiation and expansion stage
Sequence ? help Back to Top
Protein Sequence    Length: 328 aa     Download sequence    Send to blast
MDKKVSFTSS VAHSTPPYLS TSISWGLPTK SNGVTESLSL KVVDARPERL INTKNISFQD  60
QDSSSTLSSA QSSNDVTSSG DDNPSRQISF LAHSDVCKGF EETQRKRFAI KSGSSTAGIA  120
DIHSSPSKAN FSFHYADPHF GGLMPAAYLP QATIWNPQMT RVPLPFDLIE NEPVFVNAKQ  180
FHAIMRRRQQ RAKLEAQNKL IKARKPYLHE SRHVHALKRP RGSGGRFLNT KKLQESTDPK  240
QDMPIQQQHA TGNMSRFVLY QLQNSNDCDC STTSRSDITS ASDSVNLFGH SEFLISDCPS  300
QTNPTMYVHG QSNDMHGGRN THHFSVHI
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4awl_A7e-19172232363NUCLEAR TRANSCRIPTION FACTOR Y SUBUNIT ALPHA
Search in ModeBase
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
At.151740.0root
Expression -- Microarray ? help Back to Top
Source ID E-value
Genevisible260684_at0.0
Expression AtlasAT1G17590-
AtGenExpressAT1G17590-
ATTED-IIAT1G17590-
Expression -- Description ? help Back to Top
Source Description
UniprotTISSUE SPECIFICITY: Expressed in the whole plant, except roots. {ECO:0000269|PubMed:11867211}.
Functional Description ? help Back to Top
Source Description
UniProtStimulates the transcription of various genes by recognizing and binding to a CCAAT motif in promoters. {ECO:0000250}.
Function -- GeneRIF ? help Back to Top
  1. The Arabidopsis NF-YA3 and NF-YA8 genes are functionally redundant and are required in early embryogenesis.
    [PMID: 24303077]
Cis-element ? help Back to Top
SourceLink
PlantRegMapAT1G17590.4
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Interaction ? help Back to Top
Source Intact With
BioGRIDAT1G54830
Phenotype -- Mutation ? help Back to Top
Source ID
T-DNA ExpressAT1G17590
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankBT0330800.0BT033080.1 Arabidopsis thaliana unknown protein (At1g17590) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_001185024.10.0nuclear factor Y, subunit A8
RefseqNP_173202.10.0nuclear factor Y, subunit A8
RefseqNP_973850.10.0nuclear factor Y, subunit A8
RefseqNP_973851.10.0nuclear factor Y, subunit A8
SwissprotQ9LNP60.0NFYA8_ARATH; Nuclear transcription factor Y subunit A-8
TrEMBLC0SUW00.0C0SUW0_ARATH; Uncharacterized protein At1g17590 (Fragment)
STRINGAT1G17590.30.0(Arabidopsis thaliana)
Publications ? help Back to Top
  1. Riechmann JL, et al.
    Arabidopsis transcription factors: genome-wide comparative analysis among eukaryotes.
    Science, 2000. 290(5499): p. 2105-10
    [PMID:11118137]
  2. Gusmaroli G,Tonelli C,Mantovani R
    Regulation of novel members of the Arabidopsis thaliana CCAAT-binding nuclear factor Y subunits.
    Gene, 2002. 283(1-2): p. 41-8
    [PMID:11867211]
  3. Dal Bosco C, et al.
    Inactivation of the chloroplast ATP synthase gamma subunit results in high non-photochemical fluorescence quenching and altered nuclear gene expression in Arabidopsis thaliana.
    J. Biol. Chem., 2004. 279(2): p. 1060-9
    [PMID:14576160]
  4. Sunkar R,Zhu JK
    Novel and stress-regulated microRNAs and other small RNAs from Arabidopsis.
    Plant Cell, 2004. 16(8): p. 2001-19
    [PMID:15258262]
  5. Ronemus M,Vaughn MW,Martienssen RA
    MicroRNA-targeted and small interfering RNA-mediated mRNA degradation is regulated by argonaute, dicer, and RNA-dependent RNA polymerase in Arabidopsis.
    Plant Cell, 2006. 18(7): p. 1559-74
    [PMID:16798886]
  6. Manzano C,Abraham Z,L
    Identification of ubiquitinated proteins in Arabidopsis.
    Plant Mol. Biol., 2008. 68(1-2): p. 145-58
    [PMID:18535787]
  7. Wuest SE, et al.
    Arabidopsis female gametophyte gene expression map reveals similarities between plant and animal gametes.
    Curr. Biol., 2010. 20(6): p. 506-12
    [PMID:20226671]
  8. Hackenberg D, et al.
    Studies on differential nuclear translocation mechanism and assembly of the three subunits of the Arabidopsis thaliana transcription factor NF-Y.
    Mol Plant, 2012. 5(4): p. 876-88
    [PMID:22199235]
  9. Fornari M,Calvenzani V,Masiero S,Tonelli C,Petroni K
    The Arabidopsis NF-YA3 and NF-YA8 genes are functionally redundant and are required in early embryogenesis.
    PLoS ONE, 2013. 8(11): p. e82043
    [PMID:24303077]
  10. Ding Y, et al.
    Four distinct types of dehydration stress memory genes in Arabidopsis thaliana.
    BMC Plant Biol., 2013. 13: p. 229
    [PMID:24377444]
  11. Zhao H, et al.
    The Arabidopsis thaliana Nuclear Factor Y Transcription Factors.
    Front Plant Sci, 2016. 7: p. 2045
    [PMID:28119722]
  12. Djami-Tchatchou AT,Ntushelo K
    Expression Profile of Stress-responsive Arabidopsis thaliana miRNAs and their Target Genes in Response to Inoculation with Pectobacterium carotovorum subsp. carotovorum.
    Pak. J. Biol. Sci., 2017. 20(3): p. 147-153
    [PMID:29023006]