PlantTFDB
Plant Transcription Factor Database
v5.0
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID AT1G14685.3
Common NameATBPC2, BBR/BPC2, BPC2, F10B6_22, F10B6.5, T5E21.17
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis
Family BBR-BPC
Protein Properties Length: 279aa    MW: 31168.5 Da    PI: 10.2698
Description basic pentacysteine 2
Gene Model
Gene Model ID Type Source Coding Sequence
AT1G14685.3genomeTAIRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GAGA_bind362.21e-11012791301
    GAGA_bind   1 mdddgsrernkgyyepa.aslkenlglqlmssiaerdaki....rernlalsekkaavaerd....maflqrdkalaernkalverdnkllalllven 89 
                  mdddg+  rn+gyyepa a++k nlglqlms+i +r++k+    r+ nl ++++++++++++    m++    +++++       +++k++++l+v++
  AT1G14685.3   1 MDDDGF--RNWGYYEPAaATFKGNLGLQLMSTI-DRNTKPflpgRDPNL-MMGPNGSYHHQEppihMSY----NWINQ-------QKDKFFNMLPVTT 83 
                  99**99..9*******999**************.9**************.************5555555....*****.......899*******998 PP

    GAGA_bind  90 slasalpvgvqvlsgtksidslqq..lsepqledsavelreeeklealpieeaaeeakekkkkkkrqrakkpkekkakkkkkksekskkkvkkesade 185
                  +    +p++ +vl++t+s+ s+q+  +++ q+e+++v+l+e       +i+    + ++kk+k + + +++pk+kk +k+k+++++++++++++   +
  AT1G14685.3  84 A----TPNYGNVLPETSSAPSMQMnlHHHLQTEENPVKLEE-------EIV----V-QTKKRKTNAKAGSTPKAKKPRKPKDENSNNNNNNNTNV--T 163
                  6....9******************64444777777776222.......221....1.22222333567899***********8888877777777..7 PP

    GAGA_bind 186 rskaekksidlvlngvslDestlPvPvCsCtGalrqCYkWGnGGWqSaCCtttiSvyPLPvstkrrgaRiagrKmSqgafkklLekLaaeGydlsnpv 283
                  r+k  kks+dlv+ngvs+D+s+lPvP+C+CtGa++qCY+WG+GGWqSaCCtt+iS++PLP+stkrrgaRi+grKmSqgafkk+LekLa++G++++np+
  AT1G14685.3 164 RVKPAKKSVDLVINGVSMDISGLPVPICTCTGAPQQCYRWGCGGWQSACCTTNISMHPLPMSTKRRGARISGRKMSQGAFKKVLEKLASDGFNFGNPI 261
                  9************************************************************************************************* PP

    GAGA_bind 284 DLkdhWAkHGtnkfvtir 301
                  DLk+hWA+HGtnkfvtir
  AT1G14685.3 262 DLKSHWARHGTNKFVTIR 279
                  *****************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF062172.1E-991279IPR010409GAGA-binding transcriptional activator
SMARTSM012266.1E-1811279IPR010409GAGA-binding transcriptional activator
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009723Biological Processresponse to ethylene
GO:0050793Biological Processregulation of developmental process
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
Plant Ontology ? help Back to Top
PO Term PO Category PO Description
PO:0000013anatomycauline leaf
PO:0000037anatomyshoot apex
PO:0000084anatomyplant sperm cell
PO:0000230anatomyinflorescence meristem
PO:0000256anatomyroot hair cell
PO:0000262anatomytrichoblast
PO:0000293anatomyguard cell
PO:0008019anatomyleaf lamina base
PO:0009005anatomyroot
PO:0009006anatomyshoot system
PO:0009009anatomyplant embryo
PO:0009010anatomyseed
PO:0009025anatomyvascular leaf
PO:0009029anatomystamen
PO:0009030anatomycarpel
PO:0009031anatomysepal
PO:0009032anatomypetal
PO:0009046anatomyflower
PO:0009047anatomystem
PO:0009052anatomyflower pedicel
PO:0020030anatomycotyledon
PO:0020038anatomypetiole
PO:0020100anatomyhypocotyl
PO:0020137anatomyleaf apex
PO:0025022anatomycollective leaf structure
PO:0025195anatomypollen tube cell
PO:0025281anatomypollen
PO:0001016developmental stageL mature pollen stage
PO:0001017developmental stageM germinated pollen stage
PO:0001054developmental stagevascular leaf senescent stage
PO:0001078developmental stageplant embryo cotyledonary stage
PO:0001081developmental stagemature plant embryo stage
PO:0001185developmental stageplant embryo globular stage
PO:0004507developmental stageplant embryo bilateral stage
PO:0007064developmental stageLP.12 twelve leaves visible stage
PO:0007095developmental stageLP.08 eight leaves visible stage
PO:0007098developmental stageLP.02 two leaves visible stage
PO:0007103developmental stageLP.10 ten leaves visible stage
PO:0007115developmental stageLP.04 four leaves visible stage
PO:0007123developmental stageLP.06 six leaves visible stage
PO:0007611developmental stagepetal differentiation and expansion stage
PO:0007616developmental stageflowering stage
Sequence ? help Back to Top
Protein Sequence    Length: 279 aa     Download sequence    Send to blast
MDDDGFRNWG YYEPAAATFK GNLGLQLMST IDRNTKPFLP GRDPNLMMGP NGSYHHQEPP  60
IHMSYNWINQ QKDKFFNMLP VTTATPNYGN VLPETSSAPS MQMNLHHHLQ TEENPVKLEE  120
EIVVQTKKRK TNAKAGSTPK AKKPRKPKDE NSNNNNNNNT NVTRVKPAKK SVDLVINGVS  180
MDISGLPVPI CTCTGAPQQC YRWGCGGWQS ACCTTNISMH PLPMSTKRRG ARISGRKMSQ  240
GAFKKVLEKL ASDGFNFGNP IDLKSHWARH GTNKFVTIR
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
At.150240.0bud| flower| inflorescence| root| seed| silique
Expression -- Microarray ? help Back to Top
Source ID E-value
Genevisible262848_at0.0
Expression AtlasAT1G14685-
AtGenExpressAT1G14685-
ATTED-IIAT1G14685-
Expression -- Description ? help Back to Top
Source Description
UniprotTISSUE SPECIFICITY: Expressed in seedlings, leaves and pistils. Detected in the base of flowers and tips of carpels, in sepal and petal vasculature, in pollen grains, in young rosette, in the lateral and tip of primary roots, and in ovule at the exception of the outer integument. {ECO:0000269|PubMed:14731261, ECO:0000269|PubMed:21435046}.
Functional Description ? help Back to Top
Source Description
TAIRArabidopsis GBP Basic Penta Cysteine 1
UniProtTranscriptional regulator that specifically binds to GA-rich elements (GAGA-repeats) present in regulatory sequences of genes involved in developmental processes. {ECO:0000269|PubMed:14731261}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapAT1G14685.3
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Phenotype -- Mutation ? help Back to Top
Source ID
T-DNA ExpressAT1G14685
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC0069170.0AC006917.6 Genomic sequence for Arabidopsis thaliana BAC F10B6 from chromosome I, complete sequence.
GenBankAC0106570.0AC010657.3 Genomic sequence for Arabidopsis thaliana BAC T5E21 from chromosome I, complete sequence.
GenBankAY0580730.0AY058073.1 Arabidopsis thaliana At1g14680/F10B6_22 mRNA, complete cds.
GenBankAY0903050.0AY090305.1 Arabidopsis thaliana At1g14680/F10B6_22 mRNA, complete cds.
GenBankAY3805680.0AY380568.1 Arabidopsis thaliana basic pentacysteine 2 (BPC2) mRNA, complete cds.
GenBankCP0026840.0CP002684.1 Arabidopsis thaliana chromosome 1 sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_001321304.10.0basic pentacysteine 2
RefseqNP_563955.10.0basic pentacysteine 2
RefseqNP_849662.10.0basic pentacysteine 2
RefseqNP_973828.10.0basic pentacysteine 2
SwissprotQ9LDE20.0BPC2_ARATH; Protein BASIC PENTACYSTEINE2
TrEMBLA0A178W3640.0A0A178W364_ARATH; BPC2
STRINGAT1G14685.30.0(Arabidopsis thaliana)
Publications ? help Back to Top
  1. Santi L, et al.
    The GA octodinucleotide repeat binding factor BBR participates in the transcriptional regulation of the homeobox gene Bkn3.
    Plant J., 2003. 34(6): p. 813-26
    [PMID:12795701]
  2. Yamada K, et al.
    Empirical analysis of transcriptional activity in the Arabidopsis genome.
    Science, 2003. 302(5646): p. 842-6
    [PMID:14593172]
  3. Meister RJ, et al.
    Definition and interactions of a positive regulatory element of the Arabidopsis INNER NO OUTER promoter.
    Plant J., 2004. 37(3): p. 426-38
    [PMID:14731261]
  4. Sottosanto JB,Saranga Y,Blumwald E
    Impact of AtNHX1, a vacuolar Na+/H+ antiporter, upon gene expression during short- and long-term salt stress in Arabidopsis thaliana.
    BMC Plant Biol., 2007. 7: p. 18
    [PMID:17411438]
  5. Wang Y, et al.
    Transcriptome analyses show changes in gene expression to accompany pollen germination and tube growth in Arabidopsis.
    Plant Physiol., 2008. 148(3): p. 1201-11
    [PMID:18775970]
  6. Brand LH,Kirchler T,Hummel S,Chaban C,Wanke D
    DPI-ELISA: a fast and versatile method to specify the binding of plant transcription factors to DNA in vitro.
    Plant Methods, 2010. 6: p. 25
    [PMID:21108821]
  7. Monfared MM, et al.
    Overlapping and antagonistic activities of BASIC PENTACYSTEINE genes affect a range of developmental processes in Arabidopsis.
    Plant J., 2011. 66(6): p. 1020-31
    [PMID:21435046]
  8. Bruex A, et al.
    A gene regulatory network for root epidermis cell differentiation in Arabidopsis.
    PLoS Genet., 2012. 8(1): p. e1002446
    [PMID:22253603]
  9. Simonini S,Kater MM
    Class I BASIC PENTACYSTEINE factors regulate HOMEOBOX genes involved in meristem size maintenance.
    J. Exp. Bot., 2014. 65(6): p. 1455-65
    [PMID:24482368]