PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID AT1G14600.1
Common NameT5E21.10
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis
Family G2-like
Protein Properties Length: 255aa    MW: 29094.3 Da    PI: 7.5041
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
AT1G14600.1genomeTAIRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like1023.7e-322477255
      G2-like  2 prlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55
                 prlrWtpeLH++Fv+av+ LGG+ kAtPk +l++m+vkgLt++hvkSHLQ+YR 
  AT1G14600.1 24 PRLRWTPELHRSFVHAVDLLGGQYKATPKLVLKIMDVKGLTISHVKSHLQMYRG 77
                 8****************************************************5 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.602.6E-292077IPR009057Homeodomain-like
PROSITE profilePS5129411.6282080IPR017930Myb domain
TIGRFAMsTIGR015572.3E-222476IPR006447Myb domain, plants
SuperFamilySSF466893.58E-152476IPR009057Homeodomain-like
PfamPF002497.8E-82576IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
Plant Ontology ? help Back to Top
PO Term PO Category PO Description
PO:0000293anatomyguard cell
Sequence ? help Back to Top
Protein Sequence    Length: 255 aa     Download sequence    Send to blast
MGRCGRSNDG VIGGVRPYVR SPVPRLRWTP ELHRSFVHAV DLLGGQYKAT PKLVLKIMDV  60
KGLTISHVKS HLQMYRGSRI TLLGKPEESS SPSSRRRRRQ DNEEDHLHDN LSVHARNDCL  120
LGFHSFNFRE QTSATDNDDD DFLNIMNMER TKTFAGNGES IKFQSHHSLE AENTKNIWKN  180
TWRENEHEEE EELSLSLSLN HPHNHQQRWK SNASSSLSET SEAVSSSSGP FIFRDCFASS  240
KIDLNLNLSF SLLHS
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
6j4k_A1e-192579458Protein PHOSPHATE STARVATION RESPONSE 1
6j4k_B1e-192579458Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_A1e-192579357Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_B1e-192579357Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_C1e-192579357Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_D1e-192579357Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_A1e-192579458Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_C1e-192579458Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_D1e-192579458Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_F1e-192579458Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_H1e-192579458Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_J1e-192579458Protein PHOSPHATE STARVATION RESPONSE 1
Search in ModeBase
Expression -- Microarray ? help Back to Top
Source ID E-value
GEO793446390.0
Expression AtlasAT1G14600-
AtGenExpressAT1G14600-
Functional Description ? help Back to Top
Source Description
UniProtPutative transcription factor.
Cis-element ? help Back to Top
SourceLink
PlantRegMapAT1G14600.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Phenotype -- Mutation ? help Back to Top
Source ID
T-DNA ExpressAT1G14600
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAJ6304860.0AJ630486.1 Arabidopsis thaliana mRNA for hypothetical protein, clone At1g14600.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_172912.30.0Homeodomain-like superfamily protein
SwissprotQ700D90.0MYBF_ARATH; Putative Myb family transcription factor At1g14600
TrEMBLA0A178WCG00.0A0A178WCG0_ARATH; Uncharacterized protein
STRINGAT1G14600.10.0(Arabidopsis thaliana)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM46941852
Representative plantOGRP28515123
Publications ? help Back to Top
  1. Riechmann JL, et al.
    Arabidopsis transcription factors: genome-wide comparative analysis among eukaryotes.
    Science, 2000. 290(5499): p. 2105-10
    [PMID:11118137]
  2. Gong W, et al.
    Genome-wide ORFeome cloning and analysis of Arabidopsis transcription factor genes.
    Plant Physiol., 2004. 135(2): p. 773-82
    [PMID:15208423]