PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID AT1G13960.2
Common NameF16A14.18, F7A19.5, WRKY4
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis
Family WRKY
Protein Properties Length: 487aa    MW: 53050.4 Da    PI: 8.2053
Description WRKY DNA-binding protein 4
Gene Model
Gene Model ID Type Source Coding Sequence
AT1G13960.2genomeTAIRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1WRKY1092.2e-34202258259
                  --SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS- CS
         WRKY   2 dDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhe 59 
                  dDgynWrKYGqK+vkgsefprsYY+Ct +gCpvkkkvers  d++v+ei+Y+g+Hnhe
  AT1G13960.2 202 DDGYNWRKYGQKQVKGSEFPRSYYKCTNPGCPVKKKVERSL-DGQVTEIIYKGQHNHE 258
                  8****************************************.***************8 PP

2WRKY106.31.5e-33381439159
                  ---SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS- CS
         WRKY   1 ldDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhe 59 
                  ldDgy+WrKYGqK+vkg+++prsYY+Ct++gC v+k+ver+a+dpk+v++tYeg+Hnh+
  AT1G13960.2 381 LDDGYRWRKYGQKVVKGNPYPRSYYKCTTPGCGVRKHVERAATDPKAVVTTYEGKHNHD 439
                  59********************************************************7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:2.20.25.803.4E-30196260IPR003657WRKY domain
SuperFamilySSF1182902.48E-26200260IPR003657WRKY domain
SMARTSM007746.6E-39201259IPR003657WRKY domain
PROSITE profilePS5081124.857202260IPR003657WRKY domain
PfamPF031062.0E-26202258IPR003657WRKY domain
Gene3DG3DSA:2.20.25.801.3E-36366441IPR003657WRKY domain
SuperFamilySSF1182901.31E-29373441IPR003657WRKY domain
PROSITE profilePS5081137.975376441IPR003657WRKY domain
SMARTSM007743.8E-39381440IPR003657WRKY domain
PfamPF031065.7E-26382439IPR003657WRKY domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009723Biological Processresponse to ethylene
GO:0009751Biological Processresponse to salicylic acid
GO:0009753Biological Processresponse to jasmonic acid
GO:1900150Biological Processregulation of defense response to fungus
GO:1900425Biological Processnegative regulation of defense response to bacterium
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
GO:0044212Molecular Functiontranscription regulatory region DNA binding
GO:0046872Molecular Functionmetal ion binding
Plant Ontology ? help Back to Top
PO Term PO Category PO Description
PO:0000013anatomycauline leaf
PO:0000037anatomyshoot apex
PO:0000230anatomyinflorescence meristem
PO:0000293anatomyguard cell
PO:0008019anatomyleaf lamina base
PO:0009005anatomyroot
PO:0009006anatomyshoot system
PO:0009009anatomyplant embryo
PO:0009010anatomyseed
PO:0009025anatomyvascular leaf
PO:0009029anatomystamen
PO:0009030anatomycarpel
PO:0009031anatomysepal
PO:0009032anatomypetal
PO:0009046anatomyflower
PO:0009047anatomystem
PO:0020030anatomycotyledon
PO:0020038anatomypetiole
PO:0020100anatomyhypocotyl
PO:0020137anatomyleaf apex
PO:0025022anatomycollective leaf structure
PO:0025195anatomypollen tube cell
PO:0025281anatomypollen
PO:0001054developmental stagevascular leaf senescent stage
PO:0001078developmental stageplant embryo cotyledonary stage
PO:0004507developmental stageplant embryo bilateral stage
PO:0007064developmental stageLP.12 twelve leaves visible stage
PO:0007095developmental stageLP.08 eight leaves visible stage
PO:0007103developmental stageLP.10 ten leaves visible stage
PO:0007115developmental stageLP.04 four leaves visible stage
PO:0007123developmental stageLP.06 six leaves visible stage
PO:0007611developmental stagepetal differentiation and expansion stage
PO:0007616developmental stageflowering stage
Sequence ? help Back to Top
Protein Sequence    Length: 487 aa     Download sequence    Send to blast
MSEKEEAPST SKSTGAPSRP TLSLPPRPFS EMFFNGGVGF SPGPMTLVSN MFPDSDEFRS  60
FSQLLAGAMS SPATAAAAAA AATASDYQRL GEGTNSSSGD VDPRFKQNRP TAVLDLICNI  120
VQGSYGMTHQ QALAQVTAQA VQANANMQPQ TEYPPPSQVQ SFSSGQAQIP TSAPLPAQRE  180
TSDVTIIEHR SQQPLNVDKP ADDGYNWRKY GQKQVKGSEF PRSYYKCTNP GCPVKKKVER  240
SLDGQVTEII YKGQHNHEPP QNTKRGNKDN TANINGSSIN NNRGSSELGA SQFQTNSSNK  300
TKREQHEAVS QATTTEHLSE ASDGEEVGNG ETDVREKDEN EPDPKRRSTE VRISEPAPAA  360
SHRTVTEPRI IVQTTSEVDL LDDGYRWRKY GQKVVKGNPY PRSYYKCTTP GCGVRKHVER  420
AATDPKAVVT TYEGKHNHDL PAAKSSSHAA AAAQLRPDNR PGGLANLNQQ QQQQPVARLR  480
LKEEQTT
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1wj2_A2e-46202442878Probable WRKY transcription factor 4
2lex_A2e-46202442878Probable WRKY transcription factor 4
Search in ModeBase
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
At.200240.0leaf| vegetative tissue
Expression -- Microarray ? help Back to Top
Source ID E-value
Genevisible262613_at0.0
Expression AtlasAT1G13960-
AtGenExpressAT1G13960-
ATTED-IIAT1G13960-
Expression -- Description ? help Back to Top
Source Description
UniprotTISSUE SPECIFICITY: In young, mature and senescent leaves. {ECO:0000269|PubMed:11722756}.
Functional Description ? help Back to Top
Source Description
TAIREncodes WRKY DNA-binding protein 4 (WRKY4).
UniProtTranscription factor that binds specifically to the W box (5'-(T)TGAC[CT]-3'), a frequently occurring elicitor-responsive cis-acting element. Has a positive role in resistance to necrotrophic pathogens (e.g. Botrytis cinerea), but a negative effect on plant resistance to biotrophic pathogens (e.g. Pseudomonas syringae). {ECO:0000269|PubMed:18570649, ECO:0000269|PubMed:22219184}.
Function -- GeneRIF ? help Back to Top
  1. Data support that WRKY4 function as transcription factors, have a positive role in plant resistance to necrotrophic pathogens , and has a negative effect on plant resistance to biotrophic pathogens.
    [PMID: 18570649]
Cis-element ? help Back to Top
SourceLink
PlantRegMapAT1G13960.2
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: By biotic and abiotic stresses such as pathogen infection (e.g. Botrytis cinerea and Pseudomonas syringae), salicylic acid (SA), jasmonic acid (JA), ethylene (ACC), liquid infiltration or spraying, and strongly during leaf senescence. {ECO:0000269|PubMed:11449049, ECO:0000269|PubMed:11722756, ECO:0000269|PubMed:18570649}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Regulation -- ATRM (Manually Curated Target Genes) ? help Back to Top
Source Target Gene (A: Activate/R: Repress)
ATRM AT2G14610(R)
Phenotype -- Disruption Phenotype ? help Back to Top
Source Description
UniProtDISRUPTION PHENOTYPE: Increased sensitivity to the necrotrophic fungal pathogen Botrytis cinerea. {ECO:0000269|PubMed:18570649}.
Phenotype -- Mutation ? help Back to Top
Source ID
T-DNA ExpressAT1G13960
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAF2247030.0AF224703.1 Arabidopsis thaliana WRKY DNA-binding protein 4 (WRKY4) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_849658.10.0putative WRKY transcription factor 4
SwissprotQ9XI900.0WRKY4_ARATH; Probable WRKY transcription factor 4
TrEMBLD7KBF40.0D7KBF4_ARALL; WRKY DNA-binding protein 4
STRINGAT1G13960.10.0(Arabidopsis thaliana)
Publications ? help Back to Top
  1. Eulgem T,Rushton PJ,Robatzek S,Somssich IE
    The WRKY superfamily of plant transcription factors.
    Trends Plant Sci., 2000. 5(5): p. 199-206
    [PMID:10785665]
  2. Riechmann JL, et al.
    Arabidopsis transcription factors: genome-wide comparative analysis among eukaryotes.
    Science, 2000. 290(5499): p. 2105-10
    [PMID:11118137]
  3. Yu D,Chen C,Chen Z
    Evidence for an important role of WRKY DNA binding proteins in the regulation of NPR1 gene expression.
    Plant Cell, 2001. 13(7): p. 1527-40
    [PMID:11449049]
  4. Robatzek S,Somssich IE
    A new member of the Arabidopsis WRKY transcription factor family, AtWRKY6, is associated with both senescence- and defence-related processes.
    Plant J., 2001. 28(2): p. 123-33
    [PMID:11722756]
  5. Dal Bosco C, et al.
    Inactivation of the chloroplast ATP synthase gamma subunit results in high non-photochemical fluorescence quenching and altered nuclear gene expression in Arabidopsis thaliana.
    J. Biol. Chem., 2004. 279(2): p. 1060-9
    [PMID:14576160]
  6. Yamada K, et al.
    Empirical analysis of transcriptional activity in the Arabidopsis genome.
    Science, 2003. 302(5646): p. 842-6
    [PMID:14593172]
  7. Yamasaki K, et al.
    Solution structure of an Arabidopsis WRKY DNA binding domain.
    Plant Cell, 2005. 17(3): p. 944-56
    [PMID:15705956]
  8. Andersson-Gunner
    Biosynthesis of cellulose-enriched tension wood in Populus: global analysis of transcripts and metabolites identifies biochemical and developmental regulators in secondary wall biosynthesis.
    Plant J., 2006. 45(2): p. 144-65
    [PMID:16367961]
  9. Lai Z,Vinod K,Zheng Z,Fan B,Chen Z
    Roles of Arabidopsis WRKY3 and WRKY4 transcription factors in plant responses to pathogens.
    BMC Plant Biol., 2008. 8: p. 68
    [PMID:18570649]
  10. Wang Y, et al.
    Transcriptome analyses show changes in gene expression to accompany pollen germination and tube growth in Arabidopsis.
    Plant Physiol., 2008. 148(3): p. 1201-11
    [PMID:18775970]
  11. Miller MJ,Barrett-Wilt GA,Hua Z,Vierstra RD
    Proteomic analyses identify a diverse array of nuclear processes affected by small ubiquitin-like modifier conjugation in Arabidopsis.
    Proc. Natl. Acad. Sci. U.S.A., 2010. 107(38): p. 16512-7
    [PMID:20813957]
  12. Gaudinier A, et al.
    Enhanced Y1H assays for Arabidopsis.
    Nat. Methods, 2011. 8(12): p. 1053-5
    [PMID:22037706]
  13. Yamasaki K, et al.
    Structural basis for sequence-specific DNA recognition by an Arabidopsis WRKY transcription factor.
    J. Biol. Chem., 2012. 287(10): p. 7683-91
    [PMID:22219184]
  14. Rojas CM, et al.
    Glycolate oxidase modulates reactive oxygen species-mediated signal transduction during nonhost resistance in Nicotiana benthamiana and Arabidopsis.
    Plant Cell, 2012. 24(1): p. 336-52
    [PMID:22286136]
  15. Datta R,Sinha R,Chattopadhyay S
    Changes in leaf proteome profile of Arabidopsis thaliana in response to salicylic acid.
    J. Biosci., 2013. 38(2): p. 317-28
    [PMID:23660666]
  16. Jin J, et al.
    An Arabidopsis Transcriptional Regulatory Map Reveals Distinct Functional and Evolutionary Features of Novel Transcription Factors.
    Mol. Biol. Evol., 2015. 32(7): p. 1767-73
    [PMID:25750178]