PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID AT1G13600.1
Common NameAtbZIP58, bZIP58, F13B4.8, F21F23.3
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis
Family bZIP
Protein Properties Length: 196aa    MW: 22873.1 Da    PI: 5.605
Description basic leucine-zipper 58
Gene Model
Gene Model ID Type Source Coding Sequence
AT1G13600.1genomeTAIRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_139.71.1e-1286136555
                  CHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
       bZIP_1   5 krerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleelkke 55 
                  +++rr+++NRe+ArrsR RK+  ++eL   v  L + N+ L ++l++ ++ 
  AT1G13600.1  86 RKQRRMISNRESARRSRMRKQRHLDELWSQVIRLRTDNHCLMDKLNRVSES 136
                  79*******************************************998875 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003384.1E-1482146IPR004827Basic-leucine zipper domain
Gene3DG3DSA:1.20.5.1703.0E-1184136No hitNo description
PROSITE profilePS5021710.25484136IPR004827Basic-leucine zipper domain
SuperFamilySSF579595.22E-1286135No hitNo description
PfamPF001701.3E-1086138IPR004827Basic-leucine zipper domain
CDDcd147022.97E-1887137No hitNo description
PROSITE patternPS00036089104IPR004827Basic-leucine zipper domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0042803Molecular Functionprotein homodimerization activity
GO:0043565Molecular Functionsequence-specific DNA binding
GO:0046982Molecular Functionprotein heterodimerization activity
Plant Ontology ? help Back to Top
PO Term PO Category PO Description
PO:0000037anatomyshoot apex
PO:0000084anatomyplant sperm cell
PO:0000230anatomyinflorescence meristem
PO:0009005anatomyroot
PO:0009006anatomyshoot system
PO:0009009anatomyplant embryo
PO:0009010anatomyseed
PO:0009025anatomyvascular leaf
PO:0009031anatomysepal
PO:0009032anatomypetal
PO:0009046anatomyflower
PO:0009052anatomyflower pedicel
PO:0020100anatomyhypocotyl
PO:0020137anatomyleaf apex
PO:0025022anatomycollective leaf structure
PO:0025281anatomypollen
PO:0001054developmental stagevascular leaf senescent stage
PO:0001078developmental stageplant embryo cotyledonary stage
PO:0001081developmental stagemature plant embryo stage
PO:0001185developmental stageplant embryo globular stage
PO:0004507developmental stageplant embryo bilateral stage
PO:0007611developmental stagepetal differentiation and expansion stage
PO:0007616developmental stageflowering stage
Sequence ? help Back to Top
Protein Sequence    Length: 196 aa     Download sequence    Send to blast
MNTIPAELTG YFHYLPPDKY NNQTPIMESE YFNMPSSPTS CSSFYHLNGL INNNNYSSSS  60
NGQDLMTSNN STSDEDHQQS MVIDERKQRR MISNRESARR SRMRKQRHLD ELWSQVIRLR  120
TDNHCLMDKL NRVSESHELA LKENAKLKEE TSDLRQLISE IKSHNEDDNS FLRELEDSIS  180
NSRSDSNQSG RDFELC
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
198105RRSRMRKQ
Expression -- Microarray ? help Back to Top
Source ID E-value
Genevisible256131_at0.0
Expression AtlasAT1G13600-
AtGenExpressAT1G13600-
ATTED-IIAT1G13600-
Cis-element ? help Back to Top
SourceLink
PlantRegMapAT1G13600.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Interaction ? help Back to Top
Source Intact With
BioGRIDAT1G13600, AT1G75390
Phenotype -- Mutation ? help Back to Top
Source ID
T-DNA ExpressAT1G13600
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankF21F230.0AC027656.4 Sequence of BAC F21F23 from Arabidopsis thaliana chromosome 1, complete sequence.
GenBankAC0271340.0AC027134.4 Arabidopsis thaliana chromosome I BAC F13B4 genomic sequence, complete sequence.
GenBankCP0026840.0CP002684.1 Arabidopsis thaliana chromosome 1 sequence.
GenBankAF3324300.0AF332430.1 Arabidopsis thaliana clone C00105 (e) putative bZIP transcription factor (At1g13600) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_172817.21e-143basic leucine-zipper 58
TrEMBLQ9LMY81e-143Q9LMY8_ARATH; Basic leucine-zipper 58
STRINGAT1G13600.11e-143(Arabidopsis thaliana)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP31041129
MalvidsOGEM28922469
Publications ? help Back to Top
  1. Riechmann JL, et al.
    Arabidopsis transcription factors: genome-wide comparative analysis among eukaryotes.
    Science, 2000. 290(5499): p. 2105-10
    [PMID:11118137]
  2. Jakoby M, et al.
    bZIP transcription factors in Arabidopsis.
    Trends Plant Sci., 2002. 7(3): p. 106-11
    [PMID:11906833]
  3. Deppmann CD, et al.
    Dimerization specificity of all 67 B-ZIP motifs in Arabidopsis thaliana: a comparison to Homo sapiens B-ZIP motifs.
    Nucleic Acids Res., 2004. 32(11): p. 3435-45
    [PMID:15226410]
  4. Pischke MS,Huttlin EL,Hegeman AD,Sussman MR
    A transcriptome-based characterization of habituation in plant tissue culture.
    Plant Physiol., 2006. 140(4): p. 1255-78
    [PMID:16489130]
  5. Ehlert A, et al.
    Two-hybrid protein-protein interaction analysis in Arabidopsis protoplasts: establishment of a heterodimerization map of group C and group S bZIP transcription factors.
    Plant J., 2006. 46(5): p. 890-900
    [PMID:16709202]
  6. Deppmann CD,Alvania RS,Taparowsky EJ
    Cross-species annotation of basic leucine zipper factor interactions: Insight into the evolution of closed interaction networks.
    Mol. Biol. Evol., 2006. 23(8): p. 1480-92
    [PMID:16731568]
  7. Lee J, et al.
    Analysis of transcription factor HY5 genomic binding sites revealed its hierarchical role in light regulation of development.
    Plant Cell, 2007. 19(3): p. 731-49
    [PMID:17337630]
  8. Kong H, et al.
    Patterns of gene duplication in the plant SKP1 gene family in angiosperms: evidence for multiple mechanisms of rapid gene birth.
    Plant J., 2007. 50(5): p. 873-85
    [PMID:17470057]