PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID AT1G13450.1
Common NameGT-1, T6J4.18
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis
Family Trihelix
Protein Properties Length: 406aa    MW: 46675.9 Da    PI: 6.8667
Description Trihelix family protein
Gene Model
Gene Model ID Type Source Coding Sequence
AT1G13450.1genomeTAIRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1trihelix86.14.3e-2787168286
     trihelix   2 WtkqevlaLiearremeerlrrgklkkplWeevskkmrergferspkqCkekwenlnkrykkikegekkrtsessstcpyfdqle 86 
                  W ++e++ Li +rr m+  ++++k++k+lWe++s+kmre+gf rsp++C++kw+nl k++kk k++++++    s +++y++++e
  AT1G13450.1  87 WVQDETRSLIMFRRGMDGLFNTSKSNKHLWEQISSKMREKGFDRSPTMCTDKWRNLLKEFKKAKHHDRGN---GSAKMSYYKEIE 168
                  ********************************************************************94...566899***998 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.602.8E-477148IPR009057Homeodomain-like
PROSITE profilePS500908.02679143IPR017877Myb-like domain
SMARTSM007170.006283145IPR001005SANT/Myb domain
CDDcd122031.69E-2985150No hitNo description
PfamPF138371.6E-2086169No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0042802Molecular Functionidentical protein binding
GO:0043565Molecular Functionsequence-specific DNA binding
Plant Ontology ? help Back to Top
PO Term PO Category PO Description
PO:0000013anatomycauline leaf
PO:0000037anatomyshoot apex
PO:0000084anatomyplant sperm cell
PO:0000230anatomyinflorescence meristem
PO:0000293anatomyguard cell
PO:0008019anatomyleaf lamina base
PO:0009005anatomyroot
PO:0009006anatomyshoot system
PO:0009009anatomyplant embryo
PO:0009010anatomyseed
PO:0009025anatomyvascular leaf
PO:0009029anatomystamen
PO:0009030anatomycarpel
PO:0009031anatomysepal
PO:0009032anatomypetal
PO:0009046anatomyflower
PO:0009047anatomystem
PO:0009052anatomyflower pedicel
PO:0020030anatomycotyledon
PO:0020038anatomypetiole
PO:0020100anatomyhypocotyl
PO:0020137anatomyleaf apex
PO:0025022anatomycollective leaf structure
PO:0025195anatomypollen tube cell
PO:0025281anatomypollen
PO:0001017developmental stageM germinated pollen stage
PO:0001054developmental stagevascular leaf senescent stage
PO:0001078developmental stageplant embryo cotyledonary stage
PO:0001081developmental stagemature plant embryo stage
PO:0001185developmental stageplant embryo globular stage
PO:0004507developmental stageplant embryo bilateral stage
PO:0007064developmental stageLP.12 twelve leaves visible stage
PO:0007095developmental stageLP.08 eight leaves visible stage
PO:0007098developmental stageLP.02 two leaves visible stage
PO:0007103developmental stageLP.10 ten leaves visible stage
PO:0007115developmental stageLP.04 four leaves visible stage
PO:0007123developmental stageLP.06 six leaves visible stage
PO:0007611developmental stagepetal differentiation and expansion stage
PO:0007616developmental stageflowering stage
Sequence ? help Back to Top
Protein Sequence    Length: 406 aa     Download sequence    Send to blast
MFISDKSRPT DFYKDDHHNS STTSTTRDMM IDVLTTTNES VDLQSHHHHN HHNHHLHQSQ  60
PQQQILLGES SGEDHEVKAP KKRAETWVQD ETRSLIMFRR GMDGLFNTSK SNKHLWEQIS  120
SKMREKGFDR SPTMCTDKWR NLLKEFKKAK HHDRGNGSAK MSYYKEIEDI LRERSKKVTP  180
PQYNKSPNTP PTSAKVDSFM QFTDKGFDDT SISFGSVEAN GRPALNLERR LDHDGHPLAI  240
TTAVDAVAAN GVTPWNWRET PGNGDDSHGQ PFGGRVITVK FGDYTRRIGV DGSAEAIKEV  300
IRSAFGLRTR RAFWLEDEDQ IIRCLDRDMP LGNYLLRLDD GLAIRVCHYD ESNQLPVHSE  360
EKIFYTEEDY REFLARQGWS SLQVDGFRNI ENMDDLQPGA VYRGVR
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
2jmw_A1e-5681166186DNA binding protein GT-1
Search in ModeBase
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
At.4300.0flower| root| silique
Expression -- Microarray ? help Back to Top
Source ID E-value
Genevisible259412_at0.0
Expression AtlasAT1G13450-
AtGenExpressAT1G13450-
ATTED-IIAT1G13450-
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription factor that binds specifically to the core DNA sequence 5'-GGTTAA-3'. May act as a molecular switch in response to light signals. {ECO:0000269|PubMed:10437822, ECO:0000269|PubMed:15044016, ECO:0000269|PubMed:7866025}.
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00141DAP27203113Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMapAT1G13450.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Interaction ? help Back to Top
Source Intact With
IntActSearch Q9FX53
Phenotype -- Mutation ? help Back to Top
Source ID
T-DNA ExpressAT1G13450
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK2283050.0AK228305.1 Arabidopsis thaliana mRNA for hypothetical protein, complete cds, clone: RAFL14-74-C23.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_172802.20.0trihelix transcription factor GT-1
SwissprotQ9FX530.0TGT1_ARATH; Trihelix transcription factor GT-1
TrEMBLD7KQG00.0D7KQG0_ARALL; DNA binding protein GT-1
STRINGAT1G13450.10.0(Arabidopsis thaliana)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP59331318
MalvidsOGEM28912768
Publications ? help Back to Top
  1. Mar
    Modulation of GT-1 DNA-binding activity by calcium-dependent phosphorylation.
    Plant Mol. Biol., 1999. 40(3): p. 373-86
    [PMID:10437822]
  2. Riechmann JL, et al.
    Arabidopsis transcription factors: genome-wide comparative analysis among eukaryotes.
    Science, 2000. 290(5499): p. 2105-10
    [PMID:11118137]
  3. Barr
    Novel complexes of cyclin-dependent kinases and a cyclin-like protein from Arabidopsis thaliana with a function unrelated to cell division.
    Cell. Mol. Life Sci., 2003. 60(2): p. 401-12
    [PMID:12678503]
  4. Bae MS,Cho EJ,Choi EY,Park OK
    Analysis of the Arabidopsis nuclear proteome and its response to cold stress.
    Plant J., 2003. 36(5): p. 652-63
    [PMID:14617066]
  5. Castelli V, et al.
    Whole genome sequence comparisons and "full-length" cDNA sequences: a combined approach to evaluate and improve Arabidopsis genome annotation.
    Genome Res., 2004. 14(3): p. 406-13
    [PMID:14993207]
  6. Ayadi M,Delaporte V,Li YF,Zhou DX
    Analysis of GT-3a identifies a distinct subgroup of trihelix DNA-binding transcription factors in Arabidopsis.
    FEBS Lett., 2004. 562(1-3): p. 147-54
    [PMID:15044016]
  7. Park HC, et al.
    Pathogen- and NaCl-induced expression of the SCaM-4 promoter is mediated in part by a GT-1 box that interacts with a GT-1-like transcription factor.
    Plant Physiol., 2004. 135(4): p. 2150-61
    [PMID:15310827]
  8. Juenger TE, et al.
    Natural genetic variation in whole-genome expression in Arabidopsis thaliana: the impact of physiological QTL introgression.
    Mol. Ecol., 2006. 15(5): p. 1351-65
    [PMID:16626458]
  9. Soitamo AJ,Piippo M,Allahverdiyeva Y,Battchikova N,Aro EM
    Light has a specific role in modulating Arabidopsis gene expression at low temperature.
    BMC Plant Biol., 2008. 8: p. 13
    [PMID:18230142]
  10. Wang Y, et al.
    Transcriptome analyses show changes in gene expression to accompany pollen germination and tube growth in Arabidopsis.
    Plant Physiol., 2008. 148(3): p. 1201-11
    [PMID:18775970]
  11. Nagata T, et al.
    Solution structures of the trihelix DNA-binding domains of the wild-type and a phosphomimetic mutant of Arabidopsis GT-1: mechanism for an increase in DNA-binding affinity through phosphorylation.
    Proteins, 2010. 78(14): p. 3033-47
    [PMID:20717979]
  12. Brady SM, et al.
    A stele-enriched gene regulatory network in the Arabidopsis root.
    Mol. Syst. Biol., 2011. 7: p. 459
    [PMID:21245844]
  13. Hiratsuka K,Wu X,Fukuzawa H,Chua NH
    Molecular dissection of GT-1 from Arabidopsis.
    Plant Cell, 1994. 6(12): p. 1805-13
    [PMID:7866025]