PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID AT1G13300.1
Common NameHRS1, T6J4.6
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis
Family G2-like
Protein Properties Length: 344aa    MW: 39057.2 Da    PI: 6.4499
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
AT1G13300.1genomeTAIRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like100.21.3e-31181236156
      G2-like   1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRla 56 
                  k+r++W+++LH+rF++a+++LGG+++AtPk+i+e+mkv+gLt+++vkSHLQkYRl+
  AT1G13300.1 181 KQRRCWSSQLHRRFLNALQHLGGPHVATPKQIREFMKVDGLTNDEVKSHLQKYRLH 236
                  79****************************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129412.113178238IPR017930Myb domain
SuperFamilySSF466891.19E-16180239IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.604.8E-27180239IPR009057Homeodomain-like
TIGRFAMsTIGR015571.3E-28181236IPR006447Myb domain, plants
PfamPF002499.3E-6183234IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009788Biological Processnegative regulation of abscisic acid-activated signaling pathway
GO:0016036Biological Processcellular response to phosphate starvation
GO:0032107Biological Processregulation of response to nutrient levels
GO:0080022Biological Processprimary root development
GO:1901699Biological Processcellular response to nitrogen compound
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
Plant Ontology ? help Back to Top
PO Term PO Category PO Description
PO:0000256anatomyroot hair cell
PO:0009005anatomyroot
PO:0020100anatomyhypocotyl
Sequence ? help Back to Top
Protein Sequence    Length: 344 aa     Download sequence    Send to blast
MIKKFSNMDY NQKRERCGQY IEALEEERRK IHVFQRELPL CLDLVTQAIE ACKRELPEMT  60
TENMYGQPEC SEQTTGECGP VLEQFLTIKD SSTSNEEEDE EFDDEHGNHD PDNDSEDKNT  120
KSDWLKSVQL WNQPDHPLLP KEERLQQETM TRDESMRKDP MVNGGEGRKR EAEKDGGGGR  180
KQRRCWSSQL HRRFLNALQH LGGPHVATPK QIREFMKVDG LTNDEVKSHL QKYRLHTRRP  240
RQTVPNNGNS QTQHFVVVGG LWVPQSDYST GKTTGGATTS STTTTTGIYG TMAAPPPPQW  300
PSHSNYRPSI IVDEGSGSHS EGVVVRCSSP AMSSSTRNHY VKNN
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
At.203660.0root
Expression -- Microarray ? help Back to Top
Source ID E-value
Genevisible259365_at0.0
Expression AtlasAT1G13300-
AtGenExpressAT1G13300-
ATTED-IIAT1G13300-
Expression -- Description ? help Back to Top
Source Description
UniprotTISSUE SPECIFICITY: Expressed in the root hair region and root hair cells. {ECO:0000269|PubMed:19341407}.
Functional Description ? help Back to Top
Source Description
TAIROverexpression confers hypersensitivity to low phosphate-elicited inhibition of primary root growth.
UniProtTranscription factor involved in nitrate and phosphate signaling in roots. Integrates nitrate and phosphate starvation responses and adaptation of root architecture depending on nutrient availabilities. Acts downstream of the nitrate sensor and transporter NPF6.3/NRT1.1. Represses primary root development in response to phosphate deficiency conditions, only when nitrate is present (PubMed:25723764). Involved in the modulation of primary root and root hair growth in phosphate-deprived environement (PubMed:19341407). May be required for suppressing abscisic acid (ABA) signaling in germinating embryo axis, which promotes the timely germination of seeds (PubMed:22545134). {ECO:0000269|PubMed:19341407, ECO:0000269|PubMed:22545134, ECO:0000269|PubMed:25723764}.
Function -- GeneRIF ? help Back to Top
  1. HRS1 may be involved in the modulation of primary root and root hair growth in phopshate-deprived Arabidopsis seedlings.
    [PMID: 19341407]
  2. HRS1 knockout mutant (hrs1-1) exhibited significant germination delays on either normal medium or those supplemented with abscisic acid (ABA) or sodium chloride (NaCl), with the magnitude of the delay being substantially larger on the latter media.
    [PMID: 22545134]
  3. NO3- and P signalling converge via double transcriptional and post-transcriptional control of the same protein, HRS1.
    [PMID: 25723764]
  4. We propose that NIGT1/HRS1s are major regulators of N starvation responses that play an important role in optimizing N acquisition and utilization under fluctuating N conditions.
    [PMID: 29622567]
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00140DAP27203113Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMapAT1G13300.1
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: Induced by nitrate (PubMed:25723764). Down-regulated under nitrate deprivation conditions (PubMed:27419465). {ECO:0000269|PubMed:25723764, ECO:0000269|PubMed:27419465}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Phenotype -- Mutation ? help Back to Top
Source ID
T-DNA ExpressAT1G13300
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAF3673360.0AF367336.1 Arabidopsis thaliana At1g13300/T6J4_6 mRNA, complete cds.
GenBankAY1248650.0AY124865.1 Arabidopsis thaliana At1g13300/T6J4_6 mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_563926.10.0myb-like transcription factor family protein
SwissprotQ9FX670.0HRS1_ARATH; Transcription factor HRS1
TrEMBLA0A178W2E40.0A0A178W2E4_ARATH; HRS1
STRINGAT1G13300.10.0(Arabidopsis thaliana)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM135081728
Representative plantOGRP54151221
Publications ? help Back to Top
  1. Riechmann JL, et al.
    Arabidopsis transcription factors: genome-wide comparative analysis among eukaryotes.
    Science, 2000. 290(5499): p. 2105-10
    [PMID:11118137]
  2. Czechowski T,Bari RP,Stitt M,Scheible WR,Udvardi MK
    Real-time RT-PCR profiling of over 1400 Arabidopsis transcription factors: unprecedented sensitivity reveals novel root- and shoot-specific genes.
    Plant J., 2004. 38(2): p. 366-79
    [PMID:15078338]
  3. Scheible WR, et al.
    Genome-wide reprogramming of primary and secondary metabolism, protein synthesis, cellular growth processes, and the regulatory infrastructure of Arabidopsis in response to nitrogen.
    Plant Physiol., 2004. 136(1): p. 2483-99
    [PMID:15375205]
  4. Brenner WG,Romanov GA,K
    Immediate-early and delayed cytokinin response genes of Arabidopsis thaliana identified by genome-wide expression profiling reveal novel cytokinin-sensitive processes and suggest cytokinin action through transcriptional cascades.
    Plant J., 2005. 44(2): p. 314-33
    [PMID:16212609]
  5. Ro DK, et al.
    Microarray expression profiling and functional characterization of AtTPS genes: duplicated Arabidopsis thaliana sesquiterpene synthase genes At4g13280 and At4g13300 encode root-specific and wound-inducible (Z)-gamma-bisabolene synthases.
    Arch. Biochem. Biophys., 2006. 448(1-2): p. 104-16
    [PMID:16297850]
  6. Ditt RF, et al.
    The Arabidopsis thaliana transcriptome in response to Agrobacterium tumefaciens.
    Mol. Plant Microbe Interact., 2006. 19(6): p. 665-81
    [PMID:16776300]
  7. Lee DJ, et al.
    Genome-wide expression profiling of ARABIDOPSIS RESPONSE REGULATOR 7(ARR7) overexpression in cytokinin response.
    Mol. Genet. Genomics, 2007. 277(2): p. 115-37
    [PMID:17061125]
  8. Liu H, et al.
    Overexpressing HRS1 Confers Hypersensitivity to Low Phosphate-Elicited Inhibition of Primary Root Growth in Arabidopsis thaliana.
    J Integr Plant Biol, 2009. 51(4): p. 382-92
    [PMID:19341407]
  9. Wu C, et al.
    HRS1 acts as a negative regulator of abscisic acid signaling to promote timely germination of Arabidopsis seeds.
    PLoS ONE, 2012. 7(4): p. e35764
    [PMID:22545134]
  10. Medici A, et al.
    AtNIGT1/HRS1 integrates nitrate and phosphate signals at the Arabidopsis root tip.
    Nat Commun, 2015. 6: p. 6274
    [PMID:25723764]
  11. Menz J,Li Z,Schulze WX,Ludewig U
    Early nitrogen-deprivation responses in Arabidopsis roots reveal distinct differences on transcriptome and (phospho-) proteome levels between nitrate and ammonium nutrition.
    Plant J., 2016. 88(5): p. 717-734
    [PMID:27419465]
  12. Kiba T, et al.
    Repression of Nitrogen Starvation Responses by Members of the Arabidopsis GARP-Type Transcription Factor NIGT1/HRS1 Subfamily.
    Plant Cell, 2018. 30(4): p. 925-945
    [PMID:29622567]