PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID AT1G12260.1
Common NameANAC007, EMB2749, NAC007, T28K15.1, VND4
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis
Family NAC
Protein Properties Length: 395aa    MW: 45840.6 Da    PI: 6.2313
Description NAC 007
Gene Model
Gene Model ID Type Source Coding Sequence
AT1G12260.1genomeTAIRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM178.32e-5571361129
          NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpk..kvkaeek.ewyfFskrdkkyatgkrknratksgyWkatgkdkevlsk 95 
                  +ppGfrFhPtdeelv++yL+kkv++k++e+ ++ik++d+yk+ePwdL++  k+ +ee+ +wyfFs++dkky+tg+r+nratk+g+Wkatg+dk+++  
  AT1G12260.1   7 VPPGFRFHPTDEELVDYYLRKKVASKRIEI-DFIKDIDLYKIEPWDLQElcKIGHEEQsDWYFFSHKDKKYPTGTRTNRATKAGFWKATGRDKAIYL- 102
                  69****************************.99**************9544444444359*************************************. PP

          NAM  96 kgelvglkktLvfykgrapkgektdWvmheyrle 129
                  +++l+g++ktLvfykgrap+g+k+dW+mheyrle
  AT1G12260.1 103 RHSLIGMRKTLVFYKGRAPNGQKSDWIMHEYRLE 136
                  8899****************************85 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019413.92E-605156IPR003441NAC domain
PROSITE profilePS5100559.1717156IPR003441NAC domain
PfamPF023651.1E-288135IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009793Biological Processembryo development ending in seed dormancy
GO:0048759Biological Processxylem vessel member cell differentiation
GO:0071555Biological Processcell wall organization
GO:1901348Biological Processpositive regulation of secondary cell wall biogenesis
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0005515Molecular Functionprotein binding
GO:0043565Molecular Functionsequence-specific DNA binding
Plant Ontology ? help Back to Top
PO Term PO Category PO Description
PO:0000230anatomyinflorescence meristem
PO:0000293anatomyguard cell
PO:0003011anatomyroot vascular system
PO:0005849anatomyprimary xylem
PO:0009005anatomyroot
PO:0009046anatomyflower
PO:0020100anatomyhypocotyl
PO:0025195anatomypollen tube cell
PO:0025281anatomypollen
PO:0001016developmental stageL mature pollen stage
PO:0001017developmental stageM germinated pollen stage
PO:0007611developmental stagepetal differentiation and expansion stage
Sequence ? help Back to Top
Protein Sequence    Length: 395 aa     Download sequence    Send to blast
MNSFSHVPPG FRFHPTDEEL VDYYLRKKVA SKRIEIDFIK DIDLYKIEPW DLQELCKIGH  60
EEQSDWYFFS HKDKKYPTGT RTNRATKAGF WKATGRDKAI YLRHSLIGMR KTLVFYKGRA  120
PNGQKSDWIM HEYRLETDEN GTPQEEGWVV CRVFKKRLAA VRRMGDYDSS PSHWYDDQLS  180
FMASELETNG QRRILPNHHQ QQQHEHQQHM PYGLNASAYA LNNPNLQCKQ ELELHYNHLV  240
QRNHLLDESH LSFLQLPQLE SPKIQQDNSN CNSLPYGTSN IDNNSSHNAN LQQSNIAHEE  300
QLNQGNQNFS SLYMNSGNEQ VMDQVTDWRV LDKFVASQLS NEEAATASAS IQNNAKDTSN  360
AEYQVDEEKD PKRASDMGEE YTASTSSSCQ IDLWK
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3ulx_A1e-50615714169Stress-induced transcription factor NAC1
Search in ModeBase
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
At.431800.0root| silique
Expression -- Microarray ? help Back to Top
Source ID E-value
GEO3341824970.0
Genevisible261022_at0.0
Expression AtlasAT1G12260-
AtGenExpressAT1G12260-
ATTED-IIAT1G12260-
Expression -- Description ? help Back to Top
Source Description
UniprotDEVELOPMENTAL STAGE: Up-regulated during xylem vessel element formation. Expressed preferentially in procambial cells adjacent to root meristem. {ECO:0000269|PubMed:16103214, ECO:0000269|PubMed:25148240}.
UniprotTISSUE SPECIFICITY: Expressed in root, shoot and hypocotyl vascular elements, columella root caps, epidermal and cortex root cells and root-hypocotyl junctions. Observed predominantly in root imature xylem vessels (PubMed:18445131). Present in root developing xylems (PubMed:16103214, PubMed:17565617). Specifically expressed in vessels in the secondary xylem of the root-hypocotyl region, and in vessels but not in interfascicular fibers in stems (PubMed:25148240). {ECO:0000269|PubMed:16103214, ECO:0000269|PubMed:17565617, ECO:0000269|PubMed:18445131, ECO:0000269|PubMed:25148240}.
Functional Description ? help Back to Top
Source Description
TAIREncodes a NAC-domain transcription factor. Expressed in the vascular tissue.
UniProtTranscription activator that binds to the secondary wall NAC binding element (SNBE), 5'-(T/A)NN(C/T)(T/C/G)TNNNNNNNA(A/C)GN(A/C/T)(A/T)-3', in the promoter of target genes (By similarity). Involved in xylem formation by promoting the expression of secondary wall-associated transcription factors and of genes involved in secondary wall biosynthesis and programmed cell death, genes driven by the secondary wall NAC binding element (SNBE). Triggers thickening of secondary walls (PubMed:16103214, PubMed:25148240). {ECO:0000250|UniProtKB:Q9LVA1, ECO:0000269|PubMed:16103214, ECO:0000269|PubMed:25148240}.
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00136DAP27203113Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMapAT1G12260.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Interaction ? help Back to Top
Source Intact With
IntActSearch Q9FWX2
Phenotype -- Disruption Phenotype ? help Back to Top
Source Description
UniProtDISRUPTION PHENOTYPE: Embryo deffective. {ECO:0000269|Ref.7}.
Phenotype -- Mutation ? help Back to Top
Source ID
T-DNA ExpressAT1G12260
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankBT0297610.0BT029761.1 Arabidopsis thaliana At1g12260 mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_172690.10.0NAC domain-containing protein 7
SwissprotQ9FWX20.0NAC7_ARATH; NAC domain-containing protein 7
TrEMBLD7KNA90.0D7KNA9_ARALL; Putative uncharacterized protein
STRINGAT1G12260.10.0(Arabidopsis thaliana)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP1715800
MalvidsOGEM21112678
Publications ? help Back to Top
  1. Riechmann JL, et al.
    Arabidopsis transcription factors: genome-wide comparative analysis among eukaryotes.
    Science, 2000. 290(5499): p. 2105-10
    [PMID:11118137]
  2. Ooka H, et al.
    Comprehensive analysis of NAC family genes in Oryza sativa and Arabidopsis thaliana.
    DNA Res., 2003. 10(6): p. 239-47
    [PMID:15029955]
  3. Kubo M, et al.
    Transcription switches for protoxylem and metaxylem vessel formation.
    Genes Dev., 2005. 19(16): p. 1855-60
    [PMID:16103214]
  4. Zhong R,Demura T,Ye ZH
    SND1, a NAC domain transcription factor, is a key regulator of secondary wall synthesis in fibers of Arabidopsis.
    Plant Cell, 2006. 18(11): p. 3158-70
    [PMID:17114348]
  5. Ko JH,Yang SH,Park AH,Lerouxel O,Han KH
    ANAC012, a member of the plant-specific NAC transcription factor family, negatively regulates xylary fiber development in Arabidopsis thaliana.
    Plant J., 2007. 50(6): p. 1035-48
    [PMID:17565617]
  6. Yamaguchi M,Kubo M,Fukuda H,Demura T
    Vascular-related NAC-DOMAIN7 is involved in the differentiation of all types of xylem vessels in Arabidopsis roots and shoots.
    Plant J., 2008. 55(4): p. 652-64
    [PMID:18445131]
  7. Wang Y, et al.
    Transcriptome analyses show changes in gene expression to accompany pollen germination and tube growth in Arabidopsis.
    Plant Physiol., 2008. 148(3): p. 1201-11
    [PMID:18775970]
  8. Yamaguchi M, et al.
    VND-INTERACTING2, a NAC domain transcription factor, negatively regulates xylem vessel formation in Arabidopsis.
    Plant Cell, 2010. 22(4): p. 1249-63
    [PMID:20388856]
  9. Zhou J,Zhong R,Ye ZH
    Arabidopsis NAC domain proteins, VND1 to VND5, are transcriptional regulators of secondary wall biosynthesis in vessels.
    PLoS ONE, 2014. 9(8): p. e105726
    [PMID:25148240]