PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID AT1G11510.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis
Family GeBP
Protein Properties Length: 352aa    MW: 39230.8 Da    PI: 5.3298
Description DNA-binding storekeeper protein-related transcriptional regulator
Gene Model
Gene Model ID Type Source Coding Sequence
AT1G11510.1genomeTAIRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF5731216.2e-38137229297
       DUF573   2 lfqrlwseeDeivlLqGlidfkaktgkspsddidafyefvkksisfkvsksqlveKirrLKkKfkkkvkkaksgkepsfskehdqkifelskkiWg 97 
                  +fqrlw+e+Deiv+LqGlid k++tg+   ++++++ye vkksisf+vsk+ql+eK+r LKkK++++  kak+g ep+f k+hd+k+felsk +Wg
  AT1G11510.1 137 YFQRLWTEDDEIVVLQGLIDDKKDTGV---SNTNKVYELVKKSISFDVSKNQLMEKLRALKKKYENNLGKAKDGVEPTFVKPHDRKAFELSKLVWG 229
                  79************************5...59***************************************************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF045043.0E-31138229IPR007592Protein of unknown function DUF573
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 352 aa     Download sequence    Send to blast
MSRRFNPLED PPSASSSDEE GKEIARNSSS DDEDDVSSEN PSPLKTTLDA VSDSESGSDE  60
ETDSDSELEK KKDQVVTNPV DVKRAKKVKT SEKSGAKRSL EVDEAAVSMD VKRAKKVSGE  120
EEKKKSGGGG EETKKTYFQR LWTEDDEIVV LQGLIDDKKD TGVSNTNKVY ELVKKSISFD  180
VSKNQLMEKL RALKKKYENN LGKAKDGVEP TFVKPHDRKA FELSKLVWGG IRMALASGMK  240
SNEKSKKSSK FESVKHELDS SLPNSKNNCE DEVMDEGEVS FTKSSLVRSI VGLGMDELTA  300
QQGLSKLASK DMKRFYEQWK AMQAREFEFF LQKHGFLFEV LSKISEAFGS NA
Expression -- Microarray ? help Back to Top
Source ID E-value
GEO183912860.0
Expression AtlasAT1G11510-
AtGenExpressAT1G11510-
Cis-element ? help Back to Top
SourceLink
PlantRegMapAT1G11510.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Phenotype -- Mutation ? help Back to Top
Source ID
T-DNA ExpressAT1G11510
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC0116610.0AC011661.5 Genomic sequence for Arabidopsis thaliana BAC T23J18 from chromosome I, complete sequence.
GenBankCP0026840.0CP002684.1 Arabidopsis thaliana chromosome 1 sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_172618.10.0DNA-binding storekeeper protein-related transcriptional regulator
TrEMBLC0SUU60.0C0SUU6_ARATH; DNA-binding storekeeper protein-related transcriptional regulator (Fragment)
STRINGAT1G11510.10.0(Arabidopsis thaliana)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM31328181
Representative plantOGRP4222523
Publications ? help Back to Top
  1. Curaba J,Herzog M,Vachon G
    GeBP, the first member of a new gene family in Arabidopsis, encodes a nuclear protein with DNA-binding activity and is regulated by KNAT1.
    Plant J., 2003. 33(2): p. 305-17
    [PMID:12535344]
  2. Hanada K, et al.
    Functional compensation of primary and secondary metabolites by duplicate genes in Arabidopsis thaliana.
    Mol. Biol. Evol., 2011. 28(1): p. 377-82
    [PMID:20736450]