PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID AT1G08810.1
Common NameAtMYB60, MYB60
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis
Family MYB
Protein Properties Length: 280aa    MW: 32017.3 Da    PI: 6.1445
Description myb domain protein 60
Gene Model
Gene Model ID Type Source Coding Sequence
AT1G08810.1genomeTAIRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding55.71.1e-171461148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     +g+WT+eEd +lv +++++G+g+W++++   g+ R+ k+c++rw +yl
      AT1G08810.1 14 KGPWTPEEDIILVSYIQEHGPGNWRSVPTNTGLLRCSKSCRLRWTNYL 61
                     79******************************99************97 PP

2Myb_DNA-binding46.49.3e-1567112148
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                      rg++T+ E+  ++++ ++lG++ W++Ia++++  Rt++++k++w+++l
      AT1G08810.1  67 RGNFTPHEEGMIIHLQALLGNK-WASIASYLP-QRTDNDIKNYWNTHL 112
                      89********************.*********.************996 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.609.6E-24564IPR009057Homeodomain-like
PROSITE profilePS5129425.093965IPR017930Myb domain
SuperFamilySSF466891.35E-3011108IPR009057Homeodomain-like
SMARTSM007172.4E-141363IPR001005SANT/Myb domain
PfamPF002492.5E-161461IPR001005SANT/Myb domain
CDDcd001677.06E-111661No hitNo description
Gene3DG3DSA:1.10.10.608.7E-2565117IPR009057Homeodomain-like
PROSITE profilePS5129419.23966116IPR017930Myb domain
SMARTSM007174.2E-1366114IPR001005SANT/Myb domain
PfamPF002494.3E-1367112IPR001005SANT/Myb domain
CDDcd001677.90E-969112No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006357Biological Processregulation of transcription from RNA polymerase II promoter
GO:0009414Biological Processresponse to water deprivation
GO:0009416Biological Processresponse to light stimulus
GO:0009737Biological Processresponse to abscisic acid
GO:0009751Biological Processresponse to salicylic acid
GO:0009753Biological Processresponse to jasmonic acid
GO:0010118Biological Processstomatal movement
GO:0030154Biological Processcell differentiation
GO:0005634Cellular Componentnucleus
GO:0000981Molecular FunctionRNA polymerase II transcription factor activity, sequence-specific DNA binding
GO:0001135Molecular Functiontranscription factor activity, RNA polymerase II transcription factor recruiting
GO:0043565Molecular Functionsequence-specific DNA binding
GO:0044212Molecular Functiontranscription regulatory region DNA binding
Plant Ontology ? help Back to Top
PO Term PO Category PO Description
PO:0000013anatomycauline leaf
PO:0000037anatomyshoot apex
PO:0000230anatomyinflorescence meristem
PO:0000293anatomyguard cell
PO:0008019anatomyleaf lamina base
PO:0009006anatomyshoot system
PO:0009009anatomyplant embryo
PO:0009025anatomyvascular leaf
PO:0009029anatomystamen
PO:0009031anatomysepal
PO:0009032anatomypetal
PO:0009046anatomyflower
PO:0009047anatomystem
PO:0020030anatomycotyledon
PO:0020038anatomypetiole
PO:0020100anatomyhypocotyl
PO:0020137anatomyleaf apex
PO:0025022anatomycollective leaf structure
PO:0025281anatomypollen
PO:0001054developmental stagevascular leaf senescent stage
PO:0001185developmental stageplant embryo globular stage
PO:0007064developmental stageLP.12 twelve leaves visible stage
PO:0007095developmental stageLP.08 eight leaves visible stage
PO:0007098developmental stageLP.02 two leaves visible stage
PO:0007103developmental stageLP.10 ten leaves visible stage
PO:0007115developmental stageLP.04 four leaves visible stage
PO:0007123developmental stageLP.06 six leaves visible stage
PO:0007611developmental stagepetal differentiation and expansion stage
PO:0007616developmental stageflowering stage
Sequence ? help Back to Top
Protein Sequence    Length: 280 aa     Download sequence    Send to blast
MGRPPCCDKI GIKKGPWTPE EDIILVSYIQ EHGPGNWRSV PTNTGLLRCS KSCRLRWTNY  60
LRPGIKRGNF TPHEEGMIIH LQALLGNKWA SIASYLPQRT DNDIKNYWNT HLKKKLNKSD  120
SDERSRSENI ALQTSSTRNT INHRSTYASS TENISRLLEG WMRASPKSST STTFLEHKMQ  180
NRTNNFIDHH SDQFPYEQLQ GSWEEGHSKG INGDDDQGIK NSENNNGDDV HHEDGDHEDD  240
DDHNATPPLT FIEKWLLEET STTGGQMEEM SHLMELSNML
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1gv2_A1e-23141164105MYB PROTO-ONCOGENE PROTEIN
1h8a_C1e-231211625128MYB TRANSFORMING PROTEIN
Search in ModeBase
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
At.109120.0flower| seed
Expression -- Microarray ? help Back to Top
Source ID E-value
GEO306808240.0
Genevisible264782_at0.0
Expression AtlasAT1G08810-
AtGenExpressAT1G08810-
ATTED-IIAT1G08810-
Expression -- Description ? help Back to Top
Source Description
UniprotTISSUE SPECIFICITY: Specifically expressed in guard cells (PubMed:16005291, PubMed:18036199, PubMed:22088138, PubMed:23828545). Present in seedlings, leaves, stems and flowers (PubMed:16005291, PubMed:22088138). {ECO:0000269|PubMed:16005291, ECO:0000269|PubMed:18036199, ECO:0000269|PubMed:22088138, ECO:0000269|PubMed:23828545}.
Functional Description ? help Back to Top
Source Description
TAIRputative transcription factor of the R2R3-MYB gene family. Transcript increases under conditions that promote stomatal opening (white and blue light, abi1-1 mutation) and decreases under conditions that trigger stomatal closure (ABA, desiccation, darkness), with the exception of elevated CO2. Expressed exclusively in guard cells of all tissues. It is required for light-induced opening of stomata. Mutant shows reduced stomatal aperture which helps to limit water loss during drought.
UniProtTranscription factor involved in the regulation of gene (e.g. drought-regulated and flavonoid biosynthetic genes) expression and stomatal movements leading to negative regulation of responses to drought and responses to other physiological stimuli (e.g. light) (PubMed:16005291, PubMed:21637967). Promotes guard cell deflation in response to water deficit. Triggers root growth upon osmotic stress (e.g. mannitol containing medium) (PubMed:21637967). {ECO:0000269|PubMed:16005291, ECO:0000269|PubMed:21637967}.
Function -- GeneRIF ? help Back to Top
  1. AtMYB60 regulates stomatal movements and plant drought tolerance as a transcriptional modulator of physiological responses in guard cells.
    [PMID: 16005291]
  2. Overexpression of transcription factor AtMYB60 represses anthocyanin biosynthesis in lettuce.
    [PMID: 18317777]
  3. Results demonstrate that phyB and CRY might regulate stomatal opening, at least in part, by regulating MYB60 expression.
    [PMID: 19965572]
  4. MYB60 plays a dual role in abiotic stress responses in Arabidopsis through its involvement in stomatal regulation and root growth.
    [PMID: 21637967]
  5. DOF-binding sites are required for AtMYB60 guard-cells expression.
    [PMID: 22088138]
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00132DAP27203113Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMapAT1G08810.1
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: Induced by jasmonic acid (JA) and salicylic acid (SA) (PubMed:16463103). Triggered by auxin (IAA) in roots (PubMed:9839469, PubMed:21637967). Stimulated by light, UV-light and cold (PubMed:9839469). According to PubMed:16005291 and PubMed:23828545, rapidly repressed by abscisic acid (ABA) in an ABI1-dependent manner. But in contrast, according to PubMed:21637967, transiently induced by ABA in seedlings (PubMed:16005291, PubMed:21637967, PubMed:23828545). Rapidly repressed by drought. Activated by white light, but repressed by blue light and darkness (PubMed:16005291). Transiently induced by salt (NaCl) in seedlings. Induced by sucrose (PubMed:21637967). Positively regulated by SCAP1 (PubMed:23453954). {ECO:0000269|PubMed:16005291, ECO:0000269|PubMed:16463103, ECO:0000269|PubMed:21637967, ECO:0000269|PubMed:23453954, ECO:0000269|PubMed:23828545, ECO:0000269|PubMed:9839469}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Regulation -- Hormone ? help Back to Top
Source Hormone
AHDabscisic acid, auxin, ethylene, gibberellin, jasmonic acid, salicylic acid
Phenotype -- Mutation ? help Back to Top
Source ID
T-DNA ExpressAT1G08810
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK1174690.0AK117469.1 Arabidopsis thaliana At1g08810 mRNA for putative transcription factor, complete cds, clone: RAFL17-08-C21.
GenBankAY5195510.0AY519551.1 Arabidopsis thaliana MYB transcription factor (At1g08810) mRNA, complete cds.
GenBankBT0050740.0BT005074.1 Arabidopsis thaliana clone U50259 putative myb family transcription factor (At1g08810) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_172358.10.0myb domain protein 60
SwissprotQ8GYP50.0MYB60_ARATH; Transcription factor MYB60
TrEMBLA0A178WD250.0A0A178WD25_ARATH; MYB60
STRINGAT1G08810.10.0(Arabidopsis thaliana)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM4282646
Representative plantOGRP5171784
Publications ? help Back to Top
  1. Riechmann JL, et al.
    Arabidopsis transcription factors: genome-wide comparative analysis among eukaryotes.
    Science, 2000. 290(5499): p. 2105-10
    [PMID:11118137]
  2. Stracke R,Werber M,Weisshaar B
    The R2R3-MYB gene family in Arabidopsis thaliana.
    Curr. Opin. Plant Biol., 2001. 4(5): p. 447-56
    [PMID:11597504]
  3. Leonhardt N, et al.
    Microarray expression analyses of Arabidopsis guard cells and isolation of a recessive abscisic acid hypersensitive protein phosphatase 2C mutant.
    Plant Cell, 2004. 16(3): p. 596-615
    [PMID:14973164]
  4. Czechowski T,Bari RP,Stitt M,Scheible WR,Udvardi MK
    Real-time RT-PCR profiling of over 1400 Arabidopsis transcription factors: unprecedented sensitivity reveals novel root- and shoot-specific genes.
    Plant J., 2004. 38(2): p. 366-79
    [PMID:15078338]
  5. Cominelli E, et al.
    A guard-cell-specific MYB transcription factor regulates stomatal movements and plant drought tolerance.
    Curr. Biol., 2005. 15(13): p. 1196-200
    [PMID:16005291]
  6. Brenner WG,Romanov GA,K
    Immediate-early and delayed cytokinin response genes of Arabidopsis thaliana identified by genome-wide expression profiling reveal novel cytokinin-sensitive processes and suggest cytokinin action through transcriptional cascades.
    Plant J., 2005. 44(2): p. 314-33
    [PMID:16212609]
  7. Suh MC, et al.
    Cuticular lipid composition, surface structure, and gene expression in Arabidopsis stem epidermis.
    Plant Physiol., 2005. 139(4): p. 1649-65
    [PMID:16299169]
  8. Yanhui C, et al.
    The MYB transcription factor superfamily of Arabidopsis: expression analysis and phylogenetic comparison with the rice MYB family.
    Plant Mol. Biol., 2006. 60(1): p. 107-24
    [PMID:16463103]
  9. Galbiati M, et al.
    Gene trap lines identify Arabidopsis genes expressed in stomatal guard cells.
    Plant J., 2008. 53(5): p. 750-62
    [PMID:18036199]
  10. Jung C, et al.
    Overexpression of AtMYB44 enhances stomatal closure to confer abiotic stress tolerance in transgenic Arabidopsis.
    Plant Physiol., 2008. 146(2): p. 623-35
    [PMID:18162593]
  11. Park JS, et al.
    Arabidopsis R2R3-MYB transcription factor AtMYB60 functions as a transcriptional repressor of anthocyanin biosynthesis in lettuce (Lactuca sativa).
    Plant Cell Rep., 2008. 27(6): p. 985-94
    [PMID:18317777]
  12. Wang FF,Lian HL,Kang CY,Yang HQ
    Phytochrome B is involved in mediating red light-induced stomatal opening in Arabidopsis thaliana.
    Mol Plant, 2010. 3(1): p. 246-59
    [PMID:19965572]
  13. Hanada K, et al.
    Functional compensation of primary and secondary metabolites by duplicate genes in Arabidopsis thaliana.
    Mol. Biol. Evol., 2011. 28(1): p. 377-82
    [PMID:20736450]
  14. Oh JE, et al.
    A dual role for MYB60 in stomatal regulation and root growth of Arabidopsis thaliana under drought stress.
    Plant Mol. Biol., 2011. 77(1-2): p. 91-103
    [PMID:21637967]
  15. Galbiati M, et al.
    The grapevine guard cell-related VvMYB60 transcription factor is involved in the regulation of stomatal activity and is differentially expressed in response to ABA and osmotic stress.
    BMC Plant Biol., 2011. 11: p. 142
    [PMID:22018045]
  16. Cominelli E, et al.
    DOF-binding sites additively contribute to guard cell-specificity of AtMYB60 promoter.
    BMC Plant Biol., 2011. 11: p. 162
    [PMID:22088138]
  17. Efroni I, et al.
    Regulation of leaf maturation by chromatin-mediated modulation of cytokinin responses.
    Dev. Cell, 2013. 24(4): p. 438-45
    [PMID:23449474]
  18. Negi J, et al.
    A Dof transcription factor, SCAP1, is essential for the development of functional stomata in Arabidopsis.
    Curr. Biol., 2013. 23(6): p. 479-84
    [PMID:23453954]
  19. Rusconi F, et al.
    The Arabidopsis thaliana MYB60 promoter provides a tool for the spatio-temporal control of gene expression in stomatal guard cells.
    J. Exp. Bot., 2013. 64(11): p. 3361-71
    [PMID:23828545]
  20. Ding Y, et al.
    Four distinct types of dehydration stress memory genes in Arabidopsis thaliana.
    BMC Plant Biol., 2013. 13: p. 229
    [PMID:24377444]
  21. Kim D,Ntui VO,Xiong L
    Arabidopsis YAK1 regulates abscisic acid response and drought resistance.
    FEBS Lett., 2016. 590(14): p. 2201-9
    [PMID:27264339]
  22. Kranz HD, et al.
    Towards functional characterisation of the members of the R2R3-MYB gene family from Arabidopsis thaliana.
    Plant J., 1998. 16(2): p. 263-76
    [PMID:9839469]