PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID AT1G08010.2
Common NameGATA11, T6D22.28
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis
Family GATA
Protein Properties Length: 303aa    MW: 33839.1 Da    PI: 8.5871
Description GATA transcription factor 11
Gene Model
Gene Model ID Type Source Coding Sequence
AT1G08010.2genomeTAIRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GATA63.72.1e-20222256135
         GATA   1 CsnCgttkTplWRrgpdgnktLCnaCGlyyrkkgl 35 
                  C++C ttkTp+WR+gp+g+ktLCnaCG+++r+ +l
  AT1G08010.2 222 CTHCETTKTPQWREGPSGPKTLCNACGVRFRSGRL 256
                  *******************************9885 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM004012.4E-20216266IPR000679Zinc finger, GATA-type
Gene3DG3DSA:3.30.50.101.8E-15220253IPR013088Zinc finger, NHR/GATA-type
PROSITE profilePS5011412.123220252IPR000679Zinc finger, GATA-type
SuperFamilySSF577162.38E-15220279No hitNo description
CDDcd002023.09E-17221278No hitNo description
PfamPF003204.4E-18222256IPR000679Zinc finger, GATA-type
PROSITE patternPS003440222247IPR000679Zinc finger, GATA-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0030154Biological Processcell differentiation
GO:0045944Biological Processpositive regulation of transcription from RNA polymerase II promoter
GO:0005634Cellular Componentnucleus
GO:0005667Cellular Componenttranscription factor complex
GO:0000977Molecular FunctionRNA polymerase II regulatory region sequence-specific DNA binding
GO:0001085Molecular FunctionRNA polymerase II transcription factor binding
GO:0001228Molecular Functiontranscriptional activator activity, RNA polymerase II transcription regulatory region sequence-specific binding
GO:0003682Molecular Functionchromatin binding
GO:0008270Molecular Functionzinc ion binding
Plant Ontology ? help Back to Top
PO Term PO Category PO Description
PO:0000293anatomyguard cell
Sequence ? help Back to Top
Protein Sequence    Length: 303 aa     Download sequence    Send to blast
MNWLPEAEAE DDFKGLLSGD FFDDLINHLD VPLDDIDTTN GEGDWVDRFQ DLEPPPMDMF  60
PTLPSDLTSC GSGMAKAPRV DIQRNIPALK QSYSSEALSS TLHQSSAPPE IKVSKLFQSL  120
SPVSVLENSY GSLSTHNNGS QRLAFPVKGM RSKRKRPTTL RLSYLFPSEP RKPEKSTPGK  180
PESECYFSSE QHAKKKRKIH LTTRTVSSTL EASNSDGIVR KCTHCETTKT PQWREGPSGP  240
KTLCNACGVR FRSGRLVPEY RPASSPTFIP AVHSNSHRKI IEMRRKDDEQ FDSSMIRAVI  300
SRG
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
At.224300.0flower| root| seed| silique
Expression -- Microarray ? help Back to Top
Source ID E-value
GEO1453352560.0
Expression AtlasAT1G08010-
AtGenExpressAT1G08010-
Functional Description ? help Back to Top
Source Description
TAIREncodes a member of the GATA factor family of zinc finger transcription factors.
UniProtTranscriptional activator that specifically binds 5'-GATA-3' or 5'-GAT-3' motifs within gene promoters. May be involved in the regulation of some light-responsive genes (By similarity). {ECO:0000250}.
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00130DAP27203113Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMapAT1G08010.2
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Phenotype -- Mutation ? help Back to Top
Source ID
T-DNA ExpressAT1G08010
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankBT0157130.0BT015713.1 Arabidopsis thaliana At1g08010 gene, complete cds.
GenBankBT0149740.0BT014974.1 Arabidopsis thaliana At1g08010 gene, complete cds.
GenBankAK2293660.0AK229366.1 Arabidopsis thaliana mRNA for putative GATA transcription factor 3, complete cds, clone: RAFL16-61-D15.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_001077485.10.0GATA transcription factor 11
RefseqNP_172279.10.0GATA transcription factor 11
SwissprotQ6DBP80.0GAT11_ARATH; GATA transcription factor 11
TrEMBLQ0WNS00.0Q0WNS0_ARATH; Putative GATA transcription factor 3
STRINGAT1G08010.10.0(Arabidopsis thaliana)
Publications ? help Back to Top
  1. Riechmann JL, et al.
    Arabidopsis transcription factors: genome-wide comparative analysis among eukaryotes.
    Science, 2000. 290(5499): p. 2105-10
    [PMID:11118137]
  2. Jeong MJ,Jeong MJ,Shih MC
    Interaction of a GATA factor with cis-acting elements involved in light regulation of nuclear genes encoding chloroplast glyceraldehyde-3-phosphate dehydrogenase in Arabidopsis.
    Biochem. Biophys. Res. Commun., 2003. 300(2): p. 555-62
    [PMID:12504119]
  3. Reyes JC,Muro-Pastor MI,Florencio FJ
    The GATA family of transcription factors in Arabidopsis and rice.
    Plant Physiol., 2004. 134(4): p. 1718-32
    [PMID:15084732]
  4. Bi YM, et al.
    Genetic analysis of Arabidopsis GATA transcription factor gene family reveals a nitrate-inducible member important for chlorophyll synthesis and glucose sensitivity.
    Plant J., 2005. 44(4): p. 680-92
    [PMID:16262716]
  5. Manfield IW,Devlin PF,Jen CH,Westhead DR,Gilmartin PM
    Conservation, convergence, and divergence of light-responsive, circadian-regulated, and tissue-specific expression patterns during evolution of the Arabidopsis GATA gene family.
    Plant Physiol., 2007. 143(2): p. 941-58
    [PMID:17208962]
  6. Taji T, et al.
    Large-scale collection and annotation of full-length enriched cDNAs from a model halophyte, Thellungiella halophila.
    BMC Plant Biol., 2008. 8: p. 115
    [PMID:19014467]