PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID AT1G08000.1
Common NameGATA10, T6D22.9
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis
Family GATA
Protein Properties Length: 308aa    MW: 34289.9 Da    PI: 9.0425
Description GATA transcription factor 10
Gene Model
Gene Model ID Type Source Coding Sequence
AT1G08000.1genomeTAIRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GATA62.26.1e-20220254135
         GATA   1 CsnCgttkTplWRrgpdgnktLCnaCGlyyrkkgl 35 
                  C++C t++Tp+WR+gp+g+ktLCnaCG+++++ +l
  AT1G08000.1 220 CTHCETITTPQWRQGPSGPKTLCNACGVRFKSGRL 254
                  *******************************9885 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM004011.1E-19214264IPR000679Zinc finger, GATA-type
SuperFamilySSF577162.76E-15218277No hitNo description
Gene3DG3DSA:3.30.50.101.3E-15218252IPR013088Zinc finger, NHR/GATA-type
CDDcd002021.27E-16219268No hitNo description
PROSITE patternPS003440220245IPR000679Zinc finger, GATA-type
PROSITE profilePS5011412.123220250IPR000679Zinc finger, GATA-type
PfamPF003201.8E-17220254IPR000679Zinc finger, GATA-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0030154Biological Processcell differentiation
GO:0045944Biological Processpositive regulation of transcription from RNA polymerase II promoter
GO:0005634Cellular Componentnucleus
GO:0005667Cellular Componenttranscription factor complex
GO:0000977Molecular FunctionRNA polymerase II regulatory region sequence-specific DNA binding
GO:0001085Molecular FunctionRNA polymerase II transcription factor binding
GO:0001228Molecular Functiontranscriptional activator activity, RNA polymerase II transcription regulatory region sequence-specific binding
GO:0003682Molecular Functionchromatin binding
GO:0008270Molecular Functionzinc ion binding
Plant Ontology ? help Back to Top
PO Term PO Category PO Description
PO:0000293anatomyguard cell
PO:0025195anatomypollen tube cell
Sequence ? help Back to Top
Protein Sequence    Length: 308 aa     Download sequence    Send to blast
MNWLPEAEAE EHLKGILSGD FFDGLTNHLD CPLEDIDSTN GEGDWVARFQ DLEPPPLDMF  60
PALPSDLTSC PKGAARVRIP NNMIPALKQS CSSEALSGIN STPHQSSAPP DIKVSYLFQS  120
LTPVSVLENS YGSLSTQNSG SQRLAFPVKG MRSKRRRPTT VRLSYLFPFE PRKSTPGESV  180
TEGYYSSEQH AKKKRKIHLI THTESSTLES SKSDGIVRIC THCETITTPQ WRQGPSGPKT  240
LCNACGVRFK SGRLVPEYRP ASSPTFIPSV HSNSHRKIIE MRKKDDEFDT SMIRSDIQKV  300
KQGRKKMV
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
At.271300.0cell culture| flower
Expression -- Microarray ? help Back to Top
Source ID E-value
Genevisible260680_s_at0.0
Expression AtlasAT1G08000-
AtGenExpressAT1G08000-
Functional Description ? help Back to Top
Source Description
TAIREncodes a member of the GATA factor family of zinc finger transcription factors.
UniProtTranscriptional activator that specifically binds 5'-GATA-3' or 5'-GAT-3' motifs within gene promoters. May be involved in the regulation of some light-responsive genes (By similarity). {ECO:0000250}.
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00047PBM25215497Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMapAT1G08000.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Phenotype -- Mutation ? help Back to Top
Source ID
T-DNA ExpressAT1G08000
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAY0639530.0AY063953.1 Arabidopsis thaliana putative GATA transcription factor 3 (At1g08000) mRNA, complete cds.
GenBankAY0967230.0AY096723.1 Arabidopsis thaliana putative GATA transcription factor 3 (At1g08000) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_172278.10.0GATA transcription factor 10
RefseqNP_973790.10.0GATA transcription factor 10
SwissprotQ8VZP40.0GAT10_ARATH; GATA transcription factor 10
TrEMBLQ0WNS01e-171Q0WNS0_ARATH; Putative GATA transcription factor 3
STRINGAT1G08000.10.0(Arabidopsis thaliana)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP6817287
MalvidsOGEM16812589
Publications ? help Back to Top
  1. Riechmann JL, et al.
    Arabidopsis transcription factors: genome-wide comparative analysis among eukaryotes.
    Science, 2000. 290(5499): p. 2105-10
    [PMID:11118137]
  2. Jeong MJ,Jeong MJ,Shih MC
    Interaction of a GATA factor with cis-acting elements involved in light regulation of nuclear genes encoding chloroplast glyceraldehyde-3-phosphate dehydrogenase in Arabidopsis.
    Biochem. Biophys. Res. Commun., 2003. 300(2): p. 555-62
    [PMID:12504119]
  3. Yamada K, et al.
    Empirical analysis of transcriptional activity in the Arabidopsis genome.
    Science, 2003. 302(5646): p. 842-6
    [PMID:14593172]
  4. Reyes JC,Muro-Pastor MI,Florencio FJ
    The GATA family of transcription factors in Arabidopsis and rice.
    Plant Physiol., 2004. 134(4): p. 1718-32
    [PMID:15084732]
  5. Manfield IW,Devlin PF,Jen CH,Westhead DR,Gilmartin PM
    Conservation, convergence, and divergence of light-responsive, circadian-regulated, and tissue-specific expression patterns during evolution of the Arabidopsis GATA gene family.
    Plant Physiol., 2007. 143(2): p. 941-58
    [PMID:17208962]
  6. Wang Y, et al.
    Transcriptome analyses show changes in gene expression to accompany pollen germination and tube growth in Arabidopsis.
    Plant Physiol., 2008. 148(3): p. 1201-11
    [PMID:18775970]