PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID AT1G07980.1
Common NameNF-YC10
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis
Family NF-YC
Protein Properties Length: 206aa    MW: 23026.9 Da    PI: 10.266
Description nuclear factor Y, subunit C10
Gene Model
Gene Model ID Type Source Coding Sequence
AT1G07980.1genomeTAIRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NF-YC46.48.8e-151061881799
        NF-YC  17 knhelPlarikkilkadedvkmisaeaPvllskacelfileltlrswlhaeenkrrtlkksdiaaavtrtdifdflvdivprd 99 
                  ++ ++P+ ri++i+++d+   +i  +a  l+ ka e+fi  ++  ++  + + k++ ++   ++++v++ + ++fl d vp++
  AT1G07980.1 106 AKIKFPMNRIRRIMRSDNSAPQIMQDAVFLVNKATEMFIERFSEEAYDSSVKDKKKFIHYKHLSSVVSNDQRYEFLADSVPEK 188
                  4678****************************************************************************986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF471134.35E-2190188IPR009072Histone-fold
PfamPF008081.5E-21109172IPR003958Transcription factor CBF/NF-Y/archaeal histone domain
Gene3DG3DSA:1.10.20.101.3E-23110187IPR009072Histone-fold
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0046982Molecular Functionprotein heterodimerization activity
Plant Ontology ? help Back to Top
PO Term PO Category PO Description
PO:0000013anatomycauline leaf
PO:0000037anatomyshoot apex
PO:0000230anatomyinflorescence meristem
PO:0000293anatomyguard cell
PO:0008019anatomyleaf lamina base
PO:0009005anatomyroot
PO:0009006anatomyshoot system
PO:0009009anatomyplant embryo
PO:0009010anatomyseed
PO:0009025anatomyvascular leaf
PO:0009029anatomystamen
PO:0009030anatomycarpel
PO:0009031anatomysepal
PO:0009032anatomypetal
PO:0009046anatomyflower
PO:0009047anatomystem
PO:0009052anatomyflower pedicel
PO:0020030anatomycotyledon
PO:0020100anatomyhypocotyl
PO:0020137anatomyleaf apex
PO:0025022anatomycollective leaf structure
PO:0025281anatomypollen
PO:0001054developmental stagevascular leaf senescent stage
PO:0001078developmental stageplant embryo cotyledonary stage
PO:0001081developmental stagemature plant embryo stage
PO:0001185developmental stageplant embryo globular stage
PO:0004507developmental stageplant embryo bilateral stage
PO:0007064developmental stageLP.12 twelve leaves visible stage
PO:0007095developmental stageLP.08 eight leaves visible stage
PO:0007098developmental stageLP.02 two leaves visible stage
PO:0007103developmental stageLP.10 ten leaves visible stage
PO:0007115developmental stageLP.04 four leaves visible stage
PO:0007123developmental stageLP.06 six leaves visible stage
PO:0007611developmental stagepetal differentiation and expansion stage
PO:0007616developmental stageflowering stage
Sequence ? help Back to Top
Protein Sequence    Length: 206 aa     Download sequence    Send to blast
MVSSKKPKEK KARSDVVVNK ASGRSKRSSG SRTKKTSNKV NIVKKKPEIY EISESSSSDS  60
VEEAIRGDEA KKSNGVVSKR GNGKSVGIPT KTSKNREEDD GGAEDAKIKF PMNRIRRIMR  120
SDNSAPQIMQ DAVFLVNKAT EMFIERFSEE AYDSSVKDKK KFIHYKHLSS VVSNDQRYEF  180
LADSVPEKLK AEAALEEWER GMTDAG
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
At.154200.0flower| silique
Expression -- Microarray ? help Back to Top
Source ID E-value
GEO306804370.0
Genevisible260622_at0.0
Expression AtlasAT1G07980-
AtGenExpressAT1G07980-
ATTED-IIAT1G07980-
Function -- GeneRIF ? help Back to Top
  1. DPB3-1 associates with NF-YA and NF-YB subunits to enhance heat stress-inducible gene expression during heat stress responses in cooperation with DREB2A.
    [PMID: 25490919]
Cis-element ? help Back to Top
SourceLink
PlantRegMapAT1G07980.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Phenotype -- Mutation ? help Back to Top
Source ID
T-DNA ExpressAT1G07980
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankBT0252660.0BT025266.1 Arabidopsis thaliana At1g07980 mRNA, complete cds.
GenBankAY0868150.0AY086815.1 Arabidopsis thaliana clone 28026 mRNA, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_563803.11e-147nuclear factor Y, subunit C10
TrEMBLQ9LN091e-147Q9LN09_ARATH; At1g07980
STRINGAT1G07980.11e-146(Arabidopsis thaliana)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP86701112
MalvidsOGEM111902231
Publications ? help Back to Top
  1. Riechmann JL, et al.
    Arabidopsis transcription factors: genome-wide comparative analysis among eukaryotes.
    Science, 2000. 290(5499): p. 2105-10
    [PMID:11118137]
  2. Dal Bosco C, et al.
    Inactivation of the chloroplast ATP synthase gamma subunit results in high non-photochemical fluorescence quenching and altered nuclear gene expression in Arabidopsis thaliana.
    J. Biol. Chem., 2004. 279(2): p. 1060-9
    [PMID:14576160]
  3. Panjabi P, et al.
    Comparative mapping of Brassica juncea and Arabidopsis thaliana using Intron Polymorphism (IP) markers: homoeologous relationships, diversification and evolution of the A, B and C Brassica genomes.
    BMC Genomics, 2008. 9: p. 113
    [PMID:18315867]
  4. Elrouby N,Coupland G
    Proteome-wide screens for small ubiquitin-like modifier (SUMO) substrates identify Arabidopsis proteins implicated in diverse biological processes.
    Proc. Natl. Acad. Sci. U.S.A., 2010. 107(40): p. 17415-20
    [PMID:20855607]
  5. Arabidopsis Interactome Mapping Consortium
    Evidence for network evolution in an Arabidopsis interactome map.
    Science, 2011. 333(6042): p. 601-7
    [PMID:21798944]
  6. Hackenberg D, et al.
    Studies on differential nuclear translocation mechanism and assembly of the three subunits of the Arabidopsis thaliana transcription factor NF-Y.
    Mol Plant, 2012. 5(4): p. 876-88
    [PMID:22199235]
  7. Sato H, et al.
    Arabidopsis DPB3-1, a DREB2A interactor, specifically enhances heat stress-induced gene expression by forming a heat stress-specific transcriptional complex with NF-Y subunits.
    Plant Cell, 2014. 26(12): p. 4954-73
    [PMID:25490919]