PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID AT1G07900.1
Common NameASL8, F24B9.1, LBD1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis
Family LBD
Protein Properties Length: 190aa    MW: 21410.3 Da    PI: 5.2824
Description LOB domain-containing protein 1
Gene Model
Gene Model ID Type Source Coding Sequence
AT1G07900.1genomeTAIRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF260138.42.6e-4333131199
       DUF260   1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqqleqlkaelallk 98 
                  +CaaCk+lrr+Ca+ Cvlapyfp ++p+kf ++h++FGasn++k+l++lpe++r+da++s+vyeAear+rdPvyG++g i +lq+q+++l+a+la+++
  AT1G07900.1  33 PCAACKILRRRCAERCVLAPYFPPTDPAKFTIAHRVFGASNIIKFLQELPESQRTDAVNSMVYEAEARIRDPVYGCAGAIYHLQRQVSELQAQLAKAQ 130
                  7**********************************************************************************************998 PP

       DUF260  99 e 99 
                   
  AT1G07900.1 131 V 131
                  6 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089126.34132133IPR004883Lateral organ boundaries, LOB
PfamPF031953.9E-4333130IPR004883Lateral organ boundaries, LOB
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0008150Biological Processbiological_process
GO:0005739Cellular Componentmitochondrion
Sequence ? help Back to Top
Protein Sequence    Length: 190 aa     Download sequence    Send to blast
MESKSDASVA TTPIISSSSS PPPSLSPRVV LSPCAACKIL RRRCAERCVL APYFPPTDPA  60
KFTIAHRVFG ASNIIKFLQE LPESQRTDAV NSMVYEAEAR IRDPVYGCAG AIYHLQRQVS  120
ELQAQLAKAQ VEMVNMQFQR SNLLELIYNM DQQQKQEQDN MSFESNDLGF LEDKSNTNSS  180
MLWWDPLWTC
Expression -- Microarray ? help Back to Top
Source ID E-value
GEO2402540370.0
Expression AtlasAT1G07900-
AtGenExpressAT1G07900-
Expression -- Description ? help Back to Top
Source Description
UniprotTISSUE SPECIFICITY: Expressed in young shoots, roots, stems, leaves and flowers. {ECO:0000269|PubMed:12068116}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapAT1G07900.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Regulation -- ATRM (Manually Curated Upstream Regulators) ? help Back to Top
Source Upstream Regulator (A: Activate/R: Repress)
ATRM AT3G01470 (R)
Phenotype -- Mutation ? help Back to Top
Source ID
T-DNA ExpressAT1G07900
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAB4738410.0AB473841.1 Arabidopsis thaliana ASL8 mRNA for ASYMMETRIC LEAVES2-like 8 protein, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_172268.11e-141LOB domain-containing protein 1
SwissprotQ9LQR01e-143LBD1_ARATH; LOB domain-containing protein 1
TrEMBLD7KHW81e-118D7KHW8_ARALL; LOB domain protein 1
STRINGAT1G07900.11e-141(Arabidopsis thaliana)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM114128105
Representative plantOGRP6016318
Publications ? help Back to Top
  1. Millar AH,Sweetlove LJ,Gieg
    Analysis of the Arabidopsis mitochondrial proteome.
    Plant Physiol., 2001. 127(4): p. 1711-27
    [PMID:11743115]
  2. Iwakawa H, et al.
    The ASYMMETRIC LEAVES2 gene of Arabidopsis thaliana, required for formation of a symmetric flat leaf lamina, encodes a member of a novel family of proteins characterized by cysteine repeats and a leucine zipper.
    Plant Cell Physiol., 2002. 43(5): p. 467-78
    [PMID:12040093]
  3. Shuai B,Reynaga-Peña CG,Springer PS
    The lateral organ boundaries gene defines a novel, plant-specific gene family.
    Plant Physiol., 2002. 129(2): p. 747-61
    [PMID:12068116]
  4. Dal Bosco C, et al.
    Inactivation of the chloroplast ATP synthase gamma subunit results in high non-photochemical fluorescence quenching and altered nuclear gene expression in Arabidopsis thaliana.
    J. Biol. Chem., 2004. 279(2): p. 1060-9
    [PMID:14576160]
  5. Heazlewood JL, et al.
    Experimental analysis of the Arabidopsis mitochondrial proteome highlights signaling and regulatory components, provides assessment of targeting prediction programs, and indicates plant-specific mitochondrial proteins.
    Plant Cell, 2004. 16(1): p. 241-56
    [PMID:14671022]
  6. Wagner R,Pfannschmidt T
    Eukaryotic transcription factors in plastids--Bioinformatic assessment and implications for the evolution of gene expression machineries in plants.
    Gene, 2006. 381: p. 62-70
    [PMID:16934950]
  7. Matsumura Y,Iwakawa H,Machida Y,Machida C
    Characterization of genes in the ASYMMETRIC LEAVES2/LATERAL ORGAN BOUNDARIES (AS2/LOB) family in Arabidopsis thaliana, and functional and molecular comparisons between AS2 and other family members.
    Plant J., 2009. 58(3): p. 525-37
    [PMID:19154202]
  8. Ariel F, et al.
    Environmental regulation of lateral root emergence in Medicago truncatula requires the HD-Zip I transcription factor HB1.
    Plant Cell, 2010. 22(7): p. 2171-83
    [PMID:20675575]
  9. Hanada K, et al.
    Functional compensation of primary and secondary metabolites by duplicate genes in Arabidopsis thaliana.
    Mol. Biol. Evol., 2011. 28(1): p. 377-82
    [PMID:20736450]
  10. Yordanov YS,Regan S,Busov V
    Members of the LATERAL ORGAN BOUNDARIES DOMAIN transcription factor family are involved in the regulation of secondary growth in Populus.
    Plant Cell, 2010. 22(11): p. 3662-77
    [PMID:21097711]
  11. Efroni I, et al.
    Regulation of leaf maturation by chromatin-mediated modulation of cytokinin responses.
    Dev. Cell, 2013. 24(4): p. 438-45
    [PMID:23449474]
  12. Jin J, et al.
    An Arabidopsis Transcriptional Regulatory Map Reveals Distinct Functional and Evolutionary Features of Novel Transcription Factors.
    Mol. Biol. Evol., 2015. 32(7): p. 1767-73
    [PMID:25750178]