PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID AT1G07530.1
Common NameATGRAS2, F22G5.9, GRAS2, SCL14
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis
Family GRAS
Protein Properties Length: 769aa    MW: 85929 Da    PI: 5.6461
Description SCARECROW-like 14
Gene Model
Gene Model ID Type Source Coding Sequence
AT1G07530.1genomeTAIRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS376.43.5e-1153937641373
         GRAS   1 lvelLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlarsvselykalppsetseknsseelaalklfsevsPilkfshlta 98 
                  l++lL+ cA+avs +d + a+++L +++e++sp g+  +Rla+yf++ L+arla++++++y al++++ts    ++ l+a++++  v+P+ k + + a
  AT1G07530.1 393 LRTLLVLCAQAVSVDDRRTANEMLRQIREHSSPLGNGSERLAHYFANSLEARLAGTGTQIYTALSSKKTS---AADMLKAYQTYMSVCPFKKAAIIFA 487
                  5789**************************************************************9999...9************************ PP

         GRAS  99 NqaIleavegeervHiiDfdisqGlQWpaLlqaLa.sRpegppslRiTgvgspesg..skeeleetgerLakfAeelgvpfefnvlvakrledlelee 193
                  N+ +++ +++++++HiiDf+is+G+QWpaL++ L+ sRp+g+p+lRiTg++ p+ g   +e ++etg+rLa+++++ +vpfe+n+ +a+++e++++e+
  AT1G07530.1 488 NHSMMRFTANANTIHIIDFGISYGFQWPALIHRLSlSRPGGSPKLRITGIELPQRGfrPAEGVQETGHRLARYCQRHNVPFEYNA-IAQKWETIQVED 584
                  ***********************************9******************99*****************************.7*********** PP

         GRAS 194 LrvkpgEalaVnlvlqlhrlldesvsleserdevLklvkslsPkvvvvveqeadhnsesFlerflealeyysalfdsleaklpreseerikvErellg 291
                  L++++gE ++Vn+ ++  +llde+v ++s+rd+vLkl+++++P+v++ +    ++n++ F++rf eal +ysa+fd+ ++kl+re+e r ++E+e+ g
  AT1G07530.1 585 LKLRQGEYVVVNSLFRFRNLLDETVLVNSPRDAVLKLIRKINPNVFIPAILSGNYNAPFFVTRFREALFHYSAVFDMCDSKLAREDEMRLMYEKEFYG 682
                  ************************************************************************************************** PP

         GRAS 292 reivnvvacegaerrerhetlekWrerleeaGFkpvplsekaakqaklllrkvksdgyrveeesgslvlgWkdrpLvsvSaW 373
                  reivnvvaceg+er+er et+++W++rl +aGF+++pl+++ +++ kl +++ +++ + v+++ ++l++gWk+r +++ S W
  AT1G07530.1 683 REIVNVVACEGTERVERPETYKQWQARLIRAGFRQLPLEKELMQNLKLKIENGYDKNFDVDQNGNWLLQGWKGRIVYASSLW 764
                  ******************************************************999************************* PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098566.068367745IPR005202Transcription factor GRAS
PfamPF035141.2E-112393764IPR005202Transcription factor GRAS
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009410Biological Processresponse to xenobiotic stimulus
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0005829Cellular Componentcytosol
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Plant Ontology ? help Back to Top
PO Term PO Category PO Description
PO:0000013anatomycauline leaf
PO:0000037anatomyshoot apex
PO:0000230anatomyinflorescence meristem
PO:0000293anatomyguard cell
PO:0008019anatomyleaf lamina base
PO:0009005anatomyroot
PO:0009006anatomyshoot system
PO:0009009anatomyplant embryo
PO:0009010anatomyseed
PO:0009025anatomyvascular leaf
PO:0009029anatomystamen
PO:0009030anatomycarpel
PO:0009031anatomysepal
PO:0009032anatomypetal
PO:0009046anatomyflower
PO:0009047anatomystem
PO:0009052anatomyflower pedicel
PO:0020030anatomycotyledon
PO:0020038anatomypetiole
PO:0020100anatomyhypocotyl
PO:0020137anatomyleaf apex
PO:0025022anatomycollective leaf structure
PO:0025281anatomypollen
PO:0001054developmental stagevascular leaf senescent stage
PO:0001078developmental stageplant embryo cotyledonary stage
PO:0001081developmental stagemature plant embryo stage
PO:0001185developmental stageplant embryo globular stage
PO:0004507developmental stageplant embryo bilateral stage
PO:0007064developmental stageLP.12 twelve leaves visible stage
PO:0007095developmental stageLP.08 eight leaves visible stage
PO:0007098developmental stageLP.02 two leaves visible stage
PO:0007103developmental stageLP.10 ten leaves visible stage
PO:0007115developmental stageLP.04 four leaves visible stage
PO:0007123developmental stageLP.06 six leaves visible stage
PO:0007611developmental stagepetal differentiation and expansion stage
PO:0007616developmental stageflowering stage
Sequence ? help Back to Top
Protein Sequence    Length: 769 aa     Download sequence    Send to blast
MGSYPDGFPG SMDELDFNKD FDLPPSSNQT LGLANGFYLD DLDFSSLDPP EAYPSQNNNN  60
NNINNKAVAG DLLSSSSDDA DFSDSVLKYI SQVLMEEDME EKPCMFHDAL ALQAAEKSLY  120
EALGEKYPSS SSASSVDHPE RLASDSPDGS CSGGAFSDYA STTTTTSSDS HWSVDGLENR  180
PSWLHTPMPS NFVFQSTSRS NSVTGGGGGG NSAVYGSGFG DDLVSNMFKD DELAMQFKKG  240
VEEASKFLPK SSQLFIDVDS YIPMNSGSKE NGSEVFVKTE KKDETEHHHH HSYAPPPNRL  300
TGKKSHWRDE DEDFVEERSN KQSAVYVEES ELSEMFDKIL VCGPGKPVCI LNQNFPTESA  360
KVVTAQSNGA KIRGKKSTST SHSNDSKKET ADLRTLLVLC AQAVSVDDRR TANEMLRQIR  420
EHSSPLGNGS ERLAHYFANS LEARLAGTGT QIYTALSSKK TSAADMLKAY QTYMSVCPFK  480
KAAIIFANHS MMRFTANANT IHIIDFGISY GFQWPALIHR LSLSRPGGSP KLRITGIELP  540
QRGFRPAEGV QETGHRLARY CQRHNVPFEY NAIAQKWETI QVEDLKLRQG EYVVVNSLFR  600
FRNLLDETVL VNSPRDAVLK LIRKINPNVF IPAILSGNYN APFFVTRFRE ALFHYSAVFD  660
MCDSKLARED EMRLMYEKEF YGREIVNVVA CEGTERVERP ETYKQWQARL IRAGFRQLPL  720
EKELMQNLKL KIENGYDKNF DVDQNGNWLL QGWKGRIVYA SSLWVPSSS
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5hyz_A2e-433977648374GRAS family transcription factor containing p
Search in ModeBase
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
At.219210.0flower| leaf| seed| vegetative tissue
Expression -- Microarray ? help Back to Top
Source ID E-value
GEO1453352250.0
Genevisible261062_at0.0
Expression AtlasAT1G07530-
AtGenExpressAT1G07530-
ATTED-IIAT1G07530-
Expression -- Description ? help Back to Top
Source Description
UniprotTISSUE SPECIFICITY: Expressed in roots, shoots, flowers and siliques. {ECO:0000269|PubMed:10341448, ECO:0000269|PubMed:18500650}.
Functional Description ? help Back to Top
Source Description
TAIREncodes a member of the GRAS family of transcription factors. The protein interacts with the TGA2 transcription factor and affects the transcription of stress-responsive genes. The protein is found in the nucleus and is also exported to the cytoplasm.
UniProtProbable transcription factor involved in plant development. {ECO:0000250}.
Function -- GeneRIF ? help Back to Top
  1. SCL14 interacts with class II TGA transcription factors and increases tolerance to toxic doses of xenobiotics.
    [PMID: 18984675]
Cis-element ? help Back to Top
SourceLink
PlantRegMapAT1G07530.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Regulation -- Hormone ? help Back to Top
Source Hormone
AHDsalicylic acid
Phenotype -- Mutation ? help Back to Top
Source ID
T-DNA ExpressAT1G07530
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC0224640.0AC022464.4 Genomic sequence for Arabidopsis thaliana BAC F22G5 from chromosome I, complete sequence.
GenBankCP0026840.0CP002684.1 Arabidopsis thaliana chromosome 1 sequence.
GenBankAK3167930.0AK316793.1 Arabidopsis thaliana AT1G07530 mRNA, complete cds, clone: RAFL05-11-B19.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_172233.10.0GRAS family transcription factor SCL14
SwissprotQ9XE580.0SCL14_ARATH; Scarecrow-like protein 14
TrEMBLB9DFJ30.0B9DFJ3_ARATH; AT1G07530 protein
STRINGAT1G07530.10.0(Arabidopsis thaliana)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP26615129
MalvidsOGEM35827189
Publications ? help Back to Top
  1. Pysh LD,Wysocka-Diller JW,Camilleri C,Bouchez D,Benfey PN
    The GRAS gene family in Arabidopsis: sequence characterization and basic expression analysis of the SCARECROW-LIKE genes.
    Plant J., 1999. 18(1): p. 111-9
    [PMID:10341448]
  2. Riechmann JL, et al.
    Arabidopsis transcription factors: genome-wide comparative analysis among eukaryotes.
    Science, 2000. 290(5499): p. 2105-10
    [PMID:11118137]
  3. Bolle C
    The role of GRAS proteins in plant signal transduction and development.
    Planta, 2004. 218(5): p. 683-92
    [PMID:14760535]
  4. Tian C,Wan P,Sun S,Li J,Chen M
    Genome-wide analysis of the GRAS gene family in rice and Arabidopsis.
    Plant Mol. Biol., 2004. 54(4): p. 519-32
    [PMID:15316287]
  5. Gao MJ,Parkin I,Lydiate D,Hannoufa A
    An auxin-responsive SCARECROW-like transcriptional activator interacts with histone deacetylase.
    Plant Mol. Biol., 2004. 55(3): p. 417-31
    [PMID:15604690]
  6. Pischke MS,Huttlin EL,Hegeman AD,Sussman MR
    A transcriptome-based characterization of habituation in plant tissue culture.
    Plant Physiol., 2006. 140(4): p. 1255-78
    [PMID:16489130]
  7. Juenger TE, et al.
    Natural genetic variation in whole-genome expression in Arabidopsis thaliana: the impact of physiological QTL introgression.
    Mol. Ecol., 2006. 15(5): p. 1351-65
    [PMID:16626458]
  8. Popescu SC, et al.
    Differential binding of calmodulin-related proteins to their targets revealed through high-density Arabidopsis protein microarrays.
    Proc. Natl. Acad. Sci. U.S.A., 2007. 104(11): p. 4730-5
    [PMID:17360592]
  9. Lee MH, et al.
    Large-scale analysis of the GRAS gene family in Arabidopsis thaliana.
    Plant Mol. Biol., 2008. 67(6): p. 659-70
    [PMID:18500650]
  10. Ascencio-Ib
    Global analysis of Arabidopsis gene expression uncovers a complex array of changes impacting pathogen response and cell cycle during geminivirus infection.
    Plant Physiol., 2008. 148(1): p. 436-54
    [PMID:18650403]
  11. Fode B,Siemsen T,Thurow C,Weigel R,Gatz C
    The Arabidopsis GRAS protein SCL14 interacts with class II TGA transcription factors and is essential for the activation of stress-inducible promoters.
    Plant Cell, 2008. 20(11): p. 3122-35
    [PMID:18984675]
  12. Matthes MC, et al.
    The transcriptome of cis-jasmone-induced resistance in Arabidopsis thaliana and its role in indirect defence.
    Planta, 2010. 232(5): p. 1163-80
    [PMID:20711606]