PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID AT1G06280.1
Common NameASL32, F9P14.14, LBD2
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis
Family LBD
Protein Properties Length: 206aa    MW: 23416.2 Da    PI: 10.02
Description LOB domain-containing protein 2
Gene Model
Gene Model ID Type Source Coding Sequence
AT1G06280.1genomeTAIRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF260110.31.4e-3424115192
       DUF260   1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqqleqlka 92 
                  aCa+Ck++r+kC+++C+l+pyfpa+++k+f++vhk+FG+snv+k++++++ee+r+++ +sl++eA +r++dPv G++g ++++ ++l+  k+
  AT1G06280.1  24 ACASCKHQRKKCNNECILSPYFPARKTKEFQAVHKVFGVSNVQKMVRTVREEDRTKLSDSLTWEALWRQKDPVLGSYGEYRRICEELKLYKS 115
                  7***********************************************************************************99998775 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089124.1723123IPR004883Lateral organ boundaries, LOB
PfamPF031958.5E-3224114IPR004883Lateral organ boundaries, LOB
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0008150Biological Processbiological_process
Sequence ? help Back to Top
Protein Sequence    Length: 206 aa     Download sequence    Send to blast
MMQRNSNNTS ITSNISNNSS SHQACASCKH QRKKCNNECI LSPYFPARKT KEFQAVHKVF  60
GVSNVQKMVR TVREEDRTKL SDSLTWEALW RQKDPVLGSY GEYRRICEEL KLYKSLVHNQ  120
PLIGWDNNQR VFNNNSNNKN GLAMTNSSGS GGFSVNNNGV GVNREIVNGG YASRNVQGGW  180
ENLKHDQRQQ CYAVINNGFK QHYLPL
Expression -- Microarray ? help Back to Top
Source ID
Expression AtlasAT1G06280
AtGenExpressAT1G06280
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00128DAP27203113Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMapAT1G06280.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Phenotype -- Mutation ? help Back to Top
Source ID
T-DNA ExpressAT1G06280
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankF9P140.0AC025290.3 Sequence of BAC F9P14 from Arabidopsis thaliana chromosome 1, complete sequence.
GenBankCP0026840.0CP002684.1 Arabidopsis thaliana chromosome 1 sequence.
GenBankAB4738650.0AB473865.1 Arabidopsis thaliana ASL32 mRNA for ASYMMETRIC LEAVES2-like 32 protein, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_172118.11e-153LOB domain-containing protein 2
SwissprotQ9LNB91e-155LBD2_ARATH; LOB domain-containing protein 2
TrEMBLD7KG181e-128D7KG18_ARALL; Putative uncharacterized protein
STRINGAT1G06280.11e-153(Arabidopsis thaliana)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP6016318
MalvidsOGEM105392635
Publications ? help Back to Top
  1. Iwakawa H, et al.
    The ASYMMETRIC LEAVES2 gene of Arabidopsis thaliana, required for formation of a symmetric flat leaf lamina, encodes a member of a novel family of proteins characterized by cysteine repeats and a leucine zipper.
    Plant Cell Physiol., 2002. 43(5): p. 467-78
    [PMID:12040093]
  2. Shuai B,Reynaga-Peña CG,Springer PS
    The lateral organ boundaries gene defines a novel, plant-specific gene family.
    Plant Physiol., 2002. 129(2): p. 747-61
    [PMID:12068116]
  3. Dal Bosco C, et al.
    Inactivation of the chloroplast ATP synthase gamma subunit results in high non-photochemical fluorescence quenching and altered nuclear gene expression in Arabidopsis thaliana.
    J. Biol. Chem., 2004. 279(2): p. 1060-9
    [PMID:14576160]
  4. Wagner R,Pfannschmidt T
    Eukaryotic transcription factors in plastids--Bioinformatic assessment and implications for the evolution of gene expression machineries in plants.
    Gene, 2006. 381: p. 62-70
    [PMID:16934950]
  5. Matsumura Y,Iwakawa H,Machida Y,Machida C
    Characterization of genes in the ASYMMETRIC LEAVES2/LATERAL ORGAN BOUNDARIES (AS2/LOB) family in Arabidopsis thaliana, and functional and molecular comparisons between AS2 and other family members.
    Plant J., 2009. 58(3): p. 525-37
    [PMID:19154202]
  6. Zhu J, et al.
    AtMYB103 is a crucial regulator of several pathways affecting Arabidopsis anther development.
    Sci China Life Sci, 2010. 53(9): p. 1112-22
    [PMID:21104372]